SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474256|ref|YP_720317.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474256|ref|YP_720317.1|
Domain Number 1 Region: 2-283
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.18e-49
Family Decarboxylase 0.00027
Further Details:      
 
Domain Number 2 Region: 309-496
Classification Level Classification E-value
Superfamily PRTase-like 1.14e-42
Family Phosphoribosyltransferases (PRTases) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474256|ref|YP_720317.1|
Sequence length 500
Comment bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein [Trichodesmium erythraeum IMS101]
Sequence
MNFFDKLLTSIEKNQSLLYLELDPNPESLPKQAEGKNIPAKYLLLKHPEKDNQELIQDWW
EWLHFLITQTEKYVCAYKLSLGYYQSFGIPGLQLLQQTLKTIPSEIPIILDAKHSDLKTS
TVFAQSIFADLQVDACTILPYTGFDLVVPFLLYPGKAVFLLCATANASAGVLQQYPNQEQ
PLYLKLVVEAQRWATPEKLGFEVGIMPDILGKIRQVAPERLILIQGDIAEENDINNPQKL
NQLLAAGLNINGEGLLLPIPPKLLGTAEPKTAIKSLISTINEQRLKMVKGSPTCELWLPD
ICFLQHQPHRDLILQLYNLGCIIFGDHVQASGAIFPYYIDLRKIISIPQIFHKIVTAYAE
IIQNLEFDRIAGIPYGSLPTATGLALHLERPMIFPRKEVKAYGTGRLIEGHFQPGEKIVV
VDDIMITGNSVMEGAEKLKSVGLKVEDIVVFIDHERGVKDKLQDHGYLGHSVLTLTEIAQ
TLYESNKINYEQFNILKNHH
Download sequence
Identical sequences Q119I0
gi|113474256|ref|YP_720317.1| WP_011610240.1.43450 203124.Tery_0376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]