SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474259|ref|YP_720320.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474259|ref|YP_720320.1|
Domain Number 1 Region: 21-348
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.47e-40
Family Filamentous hemagglutinin FhaB, secretion domain 0.0054
Further Details:      
 
Domain Number 2 Region: 548-673
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000155
Family P22 tailspike protein 0.08
Further Details:      
 
Domain Number 3 Region: 353-481
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000785
Family P22 tailspike protein 0.052
Further Details:      
 
Domain Number 4 Region: 675-798
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000207
Family P22 tailspike protein 0.058
Further Details:      
 
Domain Number 5 Region: 802-941
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000204
Family Filamentous hemagglutinin FhaB, secretion domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474259|ref|YP_720320.1|
Sequence length 1073
Comment filamentous hemagglutinin outer membrane protein [Trichodesmium erythraeum IMS101]
Sequence
MDKFRCQPKLSAFVALAFSLSPIVATAQIVPDDTLGKESSVVVPDNIKGIPSERLEGGAI
RDGNLFHSFGEFNVGEGQGAYFANPALIENIFTRVTGTNVSNLLGTLGVLGNANLFLINP
NGVIFGPNASLDLQGSFVVSSAESFVFNNFEFSASNPQAPPLLTINIPLGLRFQENPGPI
SARATSELKVGPRQTLGLLGGEVRLDGTVIESPGTQVELGSLAVPGVVELNEDLSFIFPE
GAARGDIFLGNEAVINVRSGGGGSITIKAQNVDVVGGSELLAGISEGLGSPEAQGGDIEI
NATGRINLADNSLIDNEVEENAVGNSGNIKIKTGALSVNNGSIIGTTISGEGTAGSVTIE
ASDAVVLDGVRDLDILTGVSSSVEEGAEGNGGVITITTGSLEVKNGAEILSINWGKGNAG
TVNINATETVVLDGGNSEFSTGIATSLEEGAEGKAGVVTITTGSLEVKNGAIIDSLTLGK
GDAGAVNINATETVVLDGENSEFATGVNSDADPGSEGNAGGVTITTGSLEVKNGAVIGAV
TFSKGDAGTVNINATETVVLDGGDSEILTGVNSSVAPGAEGNAGGVTITTGSLEVKNGAV
IGAVTFSKGDAGTVNINATETVVLDRGDSEFLTVVASSVAPGAEGKAGGVTITTGSLEVK
NGAEIEASTFSKGDAGTVNINATETVVLDGENSEILTGVTSSVEEGAEGKAGGVTVTTGS
LEVKNGAQLLAVTFGKGDAGTVNINATETVILDGGDSEILTVVASGVAQGAEGNAGGVTI
TTGSLEVKNGAGIAADTLPESTGNGSDISIDATKVTITNSSEIVVSSAGQGNSGNIFLSA
GDLFLDRGSKVSAITASGQGGNMTFNIANLFSLRNNSPISTTAGGTGNGGNINLSTEFFL
ARDDSDITANAFEGNGGNISIATQGIFSFPNSTIDASSQLGIDGVIEINTPDIDPSQGLI
KLSENVVDPDQLIAQNPCLQGEESEYIITGRGGLSPSPAQTLNSDPLEVGLVEAATGTAA
TVTPPPPPTSTAQIVPAKGWKLNEKGEVILVSYDPTNTQVQKHRANPATCQPR
Download sequence
Identical sequences Q119H7
WP_011610243.1.43450 gi|113474259|ref|YP_720320.1| 203124.Tery_0379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]