SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474267|ref|YP_720328.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474267|ref|YP_720328.1|
Domain Number 1 Region: 771-925
Classification Level Classification E-value
Superfamily beta-Roll 4.97e-31
Family Serralysin-like metalloprotease, C-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 624-722
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000275
Family Cadherin 0.0044
Further Details:      
 
Domain Number 3 Region: 180-471
Classification Level Classification E-value
Superfamily NHL repeat 0.0000112
Family NHL repeat 0.019
Further Details:      
 
Weak hits

Sequence:  gi|113474267|ref|YP_720328.1|
Domain Number - Region: 471-664
Classification Level Classification E-value
Superfamily NHL repeat 0.034
Family NHL repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474267|ref|YP_720328.1|
Sequence length 938
Comment cadherin [Trichodesmium erythraeum IMS101]
Sequence
MKLNTKSIVIIDASVENYQQLLNGVIPGVKPFLLGGDTDGIQQIGDILQKHPETDTLHII
SHGSPGCLYLGNSQLSLDTLKGYEPQLQQWQLDNLLLYGCNVAAGDGGEEFIDKLHRLTG
AEIAASKSLTGAAVKGGNWELEVRTGQTKPSLALQVEAMASYSDTLELQFEWAKHIGGQG
LTYVYRITTDSIGNVLVAGVFDDNIDIDGDGNNDFTSNKDSSTRDAYVAKFDSNGNWIWA
KQIGGRGSEDIKTITTDSSGNVLVAGGFGGNIDIDGDGNNDFSSNNDSSNNDAFAAKLDS
NGNLVWAKQIGGSVTTGNYISGIITDSSGNALVAGTFKGNIDIDGDGNNDFTSNNDGSND
SYVAKFDSNGNLVWAKRIGGSNGNSSGAITIDSSDNVLVAGGFKGNIDIDDDGNNNFTSN
GEADSYVAKFDSNGNFVWAKQFGSIRADYINSITTDSNGNVLVGGLFNSYIDIDGDGNND
FTSISDIDGYVAKLDSNGNLVWAKQFGSSLGGVVRSLTTDSSGNVLVVGNFSGDVDIDGD
GNNDFTSNGNGNHTFTAKYDSNGNLVWVKHNLHNAYTITTDSSGNVLMVSDFNGNIDIDG
DGDNDFTSNGDRNGLVVKFSDDTNSPPTDIALSNNTIDENVAANTPIGNLSSTDPDTGDT
FTYSLVSGAGDTDNGTFNISGDELTIKSSPDYENKPSYSIRVETTDAAGETYQKELTINV
NDLFDGNSGNDILRGTAAADSIYGLEGRDKLYGKGGNDIISGGADSDIVKGDSGDDQLNG
DDGRDRLYGGTGNDIISGGEDKDIVKGDSGDDQLNGDAGPDRLYGGTGNDILLGGDGNDL
LYGQGGDDELNGGPGMDRLYGSDGIDTFVLGEGQERDSIYNFAVGTDKIKLEGSLSFGQL
QIFPRGSSSLIEVTATGEELAIVLGVNAADINDGSVFI
Download sequence
Identical sequences Q119G9
203124.Tery_0387 WP_011610251.1.43450 gi|113474267|ref|YP_720328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]