SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474326|ref|YP_720387.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474326|ref|YP_720387.1|
Domain Number 1 Region: 257-633
Classification Level Classification E-value
Superfamily SIS domain 8.03e-97
Family double-SIS domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 2-248
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.35e-68
Family Class II glutamine amidotransferases 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474326|ref|YP_720387.1|
Sequence length 633
Comment glucosamine--fructose-6-phosphate aminotransferase [Trichodesmium erythraeum IMS101]
Sequence
MCGIVGYVGTQLATEILLSGLEKLEYRGYDSAGVATICNGQVKSVRAKGKLYNLREKLAG
VEMLANVGIGHTRWATHGKPEEYNAHPHTDDTERVAVVENGIVENYRELRKELESQGHKF
VSETDTEVIPHLIAEFLSNFAGNEKGRTKNRENFLEAVRQTVNKLDGAFAIAVVCADYPN
EIIVARQQAPISIGLGQGEFFCASDTPALISHTQVVVSLDNGEMARLTPLGVEVYNFDGD
RINKLPRILNWSPNLVDKNIFKHFMLKEIHEQPNVIRNCLETYINSDWDVKNIQISPTNL
NLSSSLYKNLEQVEIFACGTSWHASLIGKYLLEQLAGISTTVNYASEARYAPSPLRANTL
TIGVTQSGETADTLAALAIEQQRRLDKPVEFTSRLLGITNRVESSIASLVHQIIDIRAGV
EIGVAATKTFVAQVIAFYFLAIDLGWQRKYLSGEKIAEIINGLQKIPAQMEQILDSQNSQ
IEDFAHQFNNTQDLIFIGRGINYPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLDDQ
VPVVAIAMPGLVYEKVLSNAQEAKARDAQLIGVTPESTEVDMFDNVLAVPAVDELLSPML
TVIPLQLLAYHIAAHRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences Q119B0
gi|113474326|ref|YP_720387.1| 203124.Tery_0455 WP_011610309.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]