SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474440|ref|YP_720501.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474440|ref|YP_720501.1|
Domain Number 1 Region: 79-430
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.6e-73
Family Extended AAA-ATPase domain 0.00000000822
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000108
Family ClpX chaperone zinc binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474440|ref|YP_720501.1|
Sequence length 449
Comment ATP-dependent protease ATP-binding subunit ClpX [Trichodesmium erythraeum IMS101]
Sequence
MSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVELCNEILDEELFDSNATGAQPPIP
RPAPAPQKRGTGTKRLSISQIPKPREIKNYLDAHVIGQEEGKKVLSVAVYNHYKRLSFLE
AKKSGKSSQDEVELQKSNILLIGPTGCGKTLLAQTLADLLDVPFAVADATTLTEAGYVGE
DVENILLRLLQVADLEVDEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLE
GTVANVPPQGGRKHPYQDCIQIDTSNILFICGGAFVGLEKIVDQRIGKKSMGFIHQSGDS
YQVKEKKVVDLMKQMEPNDLVKFGLIPELIGRIPMVAVVEPLDEETLMAILTKPQNALVK
QYQKLLRMDNVKLEFEEDAVRAIAKEAFRRKTGARALRGIVEELMLDVMYELPSRKDVSR
CTITKEMVEKRSTAELLLHPSSLPKPESA
Download sequence
Identical sequences Q118P6
WP_011610422.1.43450 gi|113474440|ref|YP_720501.1| 203124.Tery_0584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]