SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474455|ref|YP_720516.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474455|ref|YP_720516.1|
Domain Number 1 Region: 221-547
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.13e-57
Family Integrin alpha N-terminal domain 0.0074
Further Details:      
 
Domain Number 2 Region: 553-663
Classification Level Classification E-value
Superfamily CalX-like 3.53e-28
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 3 Region: 784-904
Classification Level Classification E-value
Superfamily CalX-like 1.44e-27
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 4 Region: 661-776
Classification Level Classification E-value
Superfamily CalX-like 1.44e-25
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 5 Region: 928-1008
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000103
Family Collagen-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113474455|ref|YP_720516.1|
Sequence length 1012
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
Sequence
MDEDFQNNTPYSPGEKDCLFPLEINYHTGLNLDPEVASPLIETAWSQVKDELVDFILLPE
FKANIEISFDEKVNVDLVKDNIKDILTGENLPGIQVLSAADMNPAVGAYDPLTGEIYLAD
SLLGGTAQAKEQVLSDLSGVLLEELGHHLDPQLPESDSPGDEGELFRRLVRGETLDESEV
LQLRAEDDFREIRVWGVLVEVEATQKIDFEEFGPFEVDERPNWVAVGEFNGDEFLDLAVA
NENSDNVSVLLGKAYSSFGPATNFDVGDRPWSVGVGEFNGDDFSDLVVTSGPSGQVSILL
GKGDGGFGPATNFDVGDSPRSVVVEDLNGDGFSDLVVVNPWSDKVSVLLGEGKGSFGLAT
DFNVGDEPESLVVGDFDRDNIPDLAVANKFSDNVSILLGRGNGSFGRANNFDGGDGPSSL
AVGEFNGDSFLDLAVGNYFSDNISVLLGAGDGSFGSATNFRAGDEPTSIAAGEFNGDGFS
DLVVANENSDDISILLGNGNGGFGPPTNFDVGDEPESVAIGDFNGNGIADLAVANEFSGN
VSILINQTSITTVPNITISDTKIKEGNRNKTAEFTVILDNPSNEIVKVNYTTANQSAKVN
QDYRLAKGTLIFQPGETQQTITVPILGDRRDEAQEKFKLNLSSPQNANLKDAQAIGTILD
NDPLPKISIGDAKVTEGNRGQKKMTFEVRLNNPSGKTVRVNYGTVEGSAKSGEDYQEKRG
VVKFKPGQKKKIINIPIFGDTEDEQNEQFQVILSRARNAKFSDKKAVGMIRDNDEAVPKD
EIMPQISIGDAKVTEGNRGQKRMEFEVELDSASQKMVKVNYSTVDGSAKSGEDYRKKSGV
VTFKPGQTKKIVNIPILGDTQDEDNEKFQVQLSGAKNAKFSDRKGVGIIEDNDRPVPEVF
EDAIDLGVLSREPISVVDKIGFTVGPVNRNTEDYFRFEVEKEGSVSIFVDSFVQDLGIKL
YDEEESLLNQSNKGGDLKEIETILESGVYYLKVVPVGGSRTKYNLSVNIVEF
Download sequence
Identical sequences Q118N1
gi|113474455|ref|YP_720516.1| WP_011610437.1.43450 203124.Tery_0599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]