SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474517|ref|YP_720578.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474517|ref|YP_720578.1|
Domain Number 1 Region: 204-541
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.14e-58
Family Integrin alpha N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 551-660
Classification Level Classification E-value
Superfamily CalX-like 9.02e-29
Family CalX-beta domain 0.00069
Further Details:      
 
Domain Number 3 Region: 661-773
Classification Level Classification E-value
Superfamily CalX-like 1.01e-23
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 4 Region: 775-889
Classification Level Classification E-value
Superfamily Collagen-binding domain 6.41e-16
Family Collagen-binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474517|ref|YP_720578.1|
Sequence length 891
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
Sequence
MIDDGCTFPDVTFTVPDVNFMAQVSVEPLGAMGIIEEGWSEVRNNLAEFASSETFERDML
SVFGESTNVDLGRTIIDALVKGEDWPQINVVPAALMNGAAGGFDPLTGEVYLGDSLVEPL
SVVGSETREFDLVGVLTEEIAHSIEWKLNLTDTPGDEGEYLAALVNGDELSEGEIARLRG
EDDRREILNGTVIVEANSDLTFETQTFPTGDQPLGMAAADFNQDGFQDIVVANIGVANGI
SIFLGDGKGGVLTAFLSKLEGVVPALVTVGDMNRDGNQDIVTANFRNDSVTVLFGNGKGQ
FSSSSNFAVGDNPLELAVADVNRDGNLDVVTPNYYSNDVSVLLGNGDGTFMSATNFTTGG
SKPEGVVIKDINGDRNPDIMVSNVDSATVAVLPGNGDGTFGLPTSFPAGGKVYGITGKDL
NRDGKLDLVLPTLDPDGVSVMLGIGNGFFAFPTNLPVGSLPEHVAIEDLNGDRQLDLVVI
NRGSDNISVLLGKGKGLFEPAINFGVGEGPNIVVVEDFNNDGKKDIAVTNSEADTISILT
NTSKIAVADPNITISDTRITEGNKGRKNAKFTVTLDDASNKTVKVNYATANSSAKAGKDY
RKTTGTLTFKPGQTQKKINVPIFGDTIVEKNEKFQLNLSKPKNGKIKDKRGIATIRNDDK
NQPLLSIGDAQITEGDQGKKQLKFDVTLNTKVKKRVEVNYATADMTAKKGSDYQQTKGKL
IFKPNQKKKTITVPILGDTLNEDDEKFRVNLSRPKNAKLRDKRGVGLIKDNDRGGDQPGD
SFETAINLDILTGEQVVSDTIGFTEGIKRDTNDYFRFQTDKEGTFVLVLDDLLKNADVDL
YGSEQELINQSKNKGVKPESISTILDPDTYFLRVYPQGSSRTNYRLSVDLL
Download sequence
Identical sequences Q118G9
gi|113474517|ref|YP_720578.1| WP_011610498.1.43450 203124.Tery_0666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]