SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474565|ref|YP_720626.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474565|ref|YP_720626.1|
Domain Number 1 Region: 14-298
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.16e-46
Family TK-like PP module 0.0026
Further Details:      
 
Domain Number 2 Region: 307-490
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.9e-31
Family TK-like Pyr module 0.013
Further Details:      
 
Domain Number 3 Region: 503-635
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.43e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474565|ref|YP_720626.1|
Sequence length 636
Comment transketolase [Trichodesmium erythraeum IMS101]
Sequence
MTTARATFPINIESYKPLSLDPTNSILTDEQRQTLKANIQLCRDMIVFFTATGAARGVGG
HTGGPYDTVPEVMILDAFFRGAAEKFVPIFFDEAGHRVATQYLMAAIQGDLPVENLVNYR
AANSHLPGHPELGLTPGVKFSSGRLGHMWPYINGVAMANPNKAVFCLGSDGSQQEGNDAE
AARMAVAQNLNIKLLIDDNDVTIAGHPSNYLKGYDLNKTLTGHGIKVLEGDGEDLDSLYQ
RMCQAVTTAGPIAIVNKRKMCVGIEGLEGSIHGHDVIPLKLAIGYLKDRGITEAVKYLES
IEKPLQSYTYLGVSDKLGSNRNVFGDTVVSIVSGMSETERSNHLFIDSDLEGSCGLKQIR
TAFPDRFVSGGIMERGNFSAAAGFGMEPGKQGIFGTFSAFLEMCISEITMARLNKSNILC
HFSHAGIDDMADNTCHFGLNNMFADNGLDDAYETRLYFPADANQMKACVEAVFTQSGMRF
IFSTRSKVPILLDSNGKDFFGEDYKFIPGKDEVIREGTAGYIVSFGDALYRSLDALERLR
LEGIDVGLINKPTLNVIDEEMLRKVGTAPFVLVVEAFNRRTGLGSRFGSWLLERGMSPKF
AYIATHKEGCGGLWEQFPHQGIGPEGIMSKVKELVK
Download sequence
Identical sequences Q118C1
WP_011610546.1.43450 203124.Tery_0721 gi|113474565|ref|YP_720626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]