SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474804|ref|YP_720865.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474804|ref|YP_720865.1|
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 4.19e-32
Family N-terminal domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 160-249
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.3e-30
Family Middle domain of MutM-like DNA repair proteins 0.0015
Further Details:      
 
Domain Number 3 Region: 249-300
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.62e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113474804|ref|YP_720865.1|
Sequence length 300
Comment formamidopyrimidine-DNA glycosylase [Trichodesmium erythraeum IMS101]
Sequence
MPELPEVEIVKQGLNQLTLNKRILGGEVLLERTLAYPISVADFLRGLEGKAIAQWHRQGK
YLLAQLYKWGKKNSKLQEYENEDGWLGVHLRMTGQLLWVNPEESLHKHTRVRLFFGHNSS
GDKDSSNYELRFVDQRTFGKMWGVPPGKEISKVITGLQQLGLEPFSPEFSPKYLNKKLYK
RHRPIKTALLDQTTIAGLGNIYADEALFLSGIRPTTICKDLTEKQIEQLHLAILKVLQTA
INAGGTTFSNFLNVKGVNGNYGGVAWVYSRAGQPCRICNTPLEKIKLAGRSTHFCPQCQK
Download sequence
Identical sequences Q117D2
203124.Tery_1015 WP_011610779.1.43450 gi|113474804|ref|YP_720865.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]