SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474813|ref|YP_720874.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113474813|ref|YP_720874.1|
Domain Number - Region: 81-147
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.00379
Family Acetyl-CoA synthetase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474813|ref|YP_720874.1|
Sequence length 226
Comment HupE/UreJ protein [Trichodesmium erythraeum IMS101]
Sequence
MTYKHSKFTKIRMGNQLNKILTIVIVTCTSLIFFSTTELAMAHHPMGGKIPANFWEGLIS
GMGHPIIGIDHLSFVVGVGLIAAGMSNSILVLVSFLATAMLGTGIHLLSIDLPLTEIAIA
ISVVALGAMLAFKQKLNTPLVIIFAAISGIFHGYAYGEAIIGSEMTPLLAYLIGFTAMQL
FIALFAMKSAELVSSYWQNQFFRLMSFLGLFISTIGLVFFTKAILN
Download sequence
Identical sequences Q117C3
203124.Tery_1026 gi|113474813|ref|YP_720874.1| WP_011610787.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]