SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474995|ref|YP_721056.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474995|ref|YP_721056.1|
Domain Number 1 Region: 23-213
Classification Level Classification E-value
Superfamily GAF domain-like 1.02e-26
Family GAF domain 0.00022
Further Details:      
 
Domain Number 2 Region: 209-288,429-496
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000109
Family HD domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474995|ref|YP_721056.1|
Sequence length 544
Comment metal dependent phosphohydrolase [Trichodesmium erythraeum IMS101]
Sequence
MIQLNTLKLFQELTETSELLIIEQLLDIGVALSDTYNLGELLNLILSKSREITCSDAGSV
YLVDEVNFKERKLVFKVAQNDSIPELAFQEIALPIDFKSLTGYVALTGHTLNIPDAYNLP
KDIPYKFDESFDEKTGYRTCSVLILPVQKQNQEIIGVLQLINRKVQPDVVITKENAKELT
KAYSKWEQRILISLASQAAISIERNNLQENIENLFEGFVKASVQAIEARDSCTSGHSERV
AKLTVGLCQEVNIITNGVFSGTYFSNEQIQEMRYAALLHDFGKIGVPEGILTKRKKLYQE
QLELIKQRFSVAQRTLEMESAQTKYEYLLRHLSGTYQSHTQESCPLCQKIENLDLELKTA
ITQLNNYWQTILIANEPKVLAEEPLKQLQQISLYTYKDTDGQIKPLITSEEMAQLTVPRG
NLTPEERRAVEAHVTHSYEFLKQIAWTKNLQNIPEIAYGHHEKLDGSGYPRGLKKNEISL
QTQIIVIADIYDALTAGDRPYKQGLPVEAALRIMRSEAAENKINSHFLELFEQKQVFSIL
GHSK
Download sequence
Identical sequences Q116J1
gi|113474995|ref|YP_721056.1| WP_011610963.1.43450 203124.Tery_1233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]