SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475164|ref|YP_721225.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475164|ref|YP_721225.1|
Domain Number 1 Region: 2366-2543
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.63e-36
Family Intein (protein splicing domain) 0.000075
Further Details:      
 
Domain Number 2 Region: 211-318,2153-2198
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.91e-35
Family Intein (protein splicing domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 5-116
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 6.41e-34
Family N-terminal domain of DnaB helicase 0.00023
Further Details:      
 
Domain Number 4 Region: 2199-2351,2538-2600
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-23
Family RecA protein-like (ATPase-domain) 0.026
Further Details:      
 
Domain Number 5 Region: 1863-2010,2115-2198
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.89e-22
Family Intein (protein splicing domain) 0.0011
Further Details:      
 
Domain Number 6 Region: 336-401,432-464
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000317
Family Intein endonuclease 0.057
Further Details:      
 
Weak hits

Sequence:  gi|113475164|ref|YP_721225.1|
Domain Number - Region: 177-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000249
Family RecA protein-like (ATPase-domain) 0.053
Further Details:      
 
Domain Number - Region: 1611-1800
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0337
Family Intein (protein splicing domain) 0.031
Further Details:      
 
Domain Number - Region: 1025-1086
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0494
Family Intein (protein splicing domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475164|ref|YP_721225.1|
Sequence length 2605
Comment primary replicative DNA helicase [Trichodesmium erythraeum IMS101]
Sequence
MQSDRLPPQNIESEEAILGGILLDPEAINRVTELLHPEFFAIQAHQIIYKAMCQLYSQGK
PTDLMTVTSWLSDHNQLEKIGGRVKIVQLLERTVSAVNIDQYAALVLDKYIRRKLIQAGN
EIFDLGFQTATKLEIILDQAEQKIFALTQDKPQQDLVPISETLINTFQEIEDRNEGVALP
GLPCGFYDLDAMTGGFQRSDLIIVAGRPSMGKCAAYDTLVLQKDGSLVTLAEVYKRQEIE
LLTLGKNSKFYLTKPSAFIDDGIKPIFRVTTKLGRFVETTITHPFLTVNGWKPLSKLQVG
EKIAVPRRLNIFGNETISESKFSSLINFDNLYLFPLVFQLERSQLALFIRYLFSLDGWVK
IYQNKIVCFGYSTVSEKLIRQIQHILLRFGIVSGIEKFEEKRTEKIKVVKEVKSQRSHRE
EFTFATYRNCYCDGKWHLTITDALSQKNLMEDIGGFDSKNFYLFDLLQPHNSGNQELENH
LIFWDELVNVLAKFAASKNQSLKNRTAKGKSPKNSENLTTTETICRKNILANMENLPSDN
QNFDSEKLDLSQPHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSE
NLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLA
KFAASKNQSLKNRTTKRNSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQ
PHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSENLTTTETICRKN
ILANMENLPSDNQNFDSEKLDLSQPHNSGTQELENHLIFWDELVNVLAKFAASKNQSLKN
RTAKGKSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLSQPHNSGNQELENH
LIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSENLTTTETICRKNILANMENLPSDN
QNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSE
NLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLA
KFATSKNQSLKNRTTKRNSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQ
PHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSENLTTTETICRKN
ILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKN
RTTKRNSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLSQPHNSGTQELENH
LIFWDELVNVLAKFAASKNQSLKNRTTKRNSPKNSENLTTTETICRKNILANMENLPSDN
QNFDSEKLDLPQPHNSGTQELENHLIFWDELVNVLAKFAASKNQSLKNRTTKRNSPKNSE
NLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLA
KFAASKNQSLKNRTTKRNSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQ
PHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSENLTTTETICRKN
ILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKN
RTAKGKSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENH
LIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSENLTTTETICRKNILANMENLPSDN
QNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSE
NLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLA
KFATSKNQSLKNRTAKGKSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQ
PHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKNRTTKRNSPKNSENLTTTETICRKN
ILANMENLPSDNQNFDSEKLDLPQPHNSGNQELENHLIFWDELVNVLAKFATSKNQSLKN
RTTKRNSPKNSENLTTTETICRKNILANMENLPSDNQNFDSEKLDLPQPHNSGTQELENS
DIFWDKIVSIEPVGEKQVYDLTVPETHNFVANDICLHNTSFAVNIAHSIAANLKLPIAIF
SLEMSKEQLVLRLLASEARIESNRLRAGRISQNEWEPLTSAITNLSEMPIFIDDTPNITV
NEIRSKTRQLQSEQGGKLGLILLDYLQLMEGNNSDNRVLELARITRNLKGLARELSVPII
ALSQLSRSVEARTNKRPMMSDLRESGCLTGESLICLADGKKIPISCLVGNSNFAVLALNE
NTWKFESAMVSRVFSTGVKPIFSLQTSSGKLIRATANHPFFSMGGWKQLNTLNIGDSLAI
LNQKMLKCSILYDGHFLSQSDFGPKYGRNLGSIVKSHEWEKSTEIDVEWDEIVEIMPHGE
AEVFDLTVPGLHNFVANEIVVHNSIEQDADLVIMLYRDEYYSPDTPDQGIAEVIITKHRN
GPTGTVKLLFDPQFTKFRNLAVDKR
Download sequence
Identical sequences Q115S2
gi|113475164|ref|YP_721225.1| 203124.Tery_1462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]