SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475335|ref|YP_721396.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475335|ref|YP_721396.1|
Domain Number 1 Region: 45-148
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000111
Family Collagen-binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475335|ref|YP_721396.1|
Sequence length 167
Comment peptidase-like protein [Trichodesmium erythraeum IMS101]
Sequence
MSVQKKSNKSLRSYSLATISDNGSLHLTVGEYDKLLVGGIQLSNGKNFDPGNSKDKAFNI
GSLSDKFQLDESVGKSDRQDFYKFTVEEQRKVEIKLMGLTANADLYLLPEKGKVIDKSKN
GGKKNEKITATLEPDTTYYLQVQPRNKTIKMLIIISVWILEKQQIIL
Download sequence
Identical sequences Q115A1
WP_011611298.1.43450 203124.Tery_1649 gi|113475335|ref|YP_721396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]