SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475511|ref|YP_721572.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475511|ref|YP_721572.1|
Domain Number 1 Region: 17-211,312-401
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.77e-88
Family Bacterial dinuclear zinc exopeptidases 0.0000253
Further Details:      
 
Domain Number 2 Region: 198-310
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.75e-32
Family Bacterial exopeptidase dimerisation domain 0.0000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475511|ref|YP_721572.1|
Sequence length 405
Comment amidohydrolase [Trichodesmium erythraeum IMS101]
Sequence
MVSTIPNSNSLIESQLRPEIRKMQPLLVEWRRHLHQRPELGFKEHLTAKFIAQKLQEWGI
EHQTGIANTGIVATINSNKPGRVLAIRADLDALPIQELNDVPYRSIHNGVMHACGHDGHT
AIALGTAHYLATHPENFSGIVKIIFQPAEEGPGGSKPMIEAGVLKNPDVDAIIGLHLWNN
LPLGTLGVRSGALMAASERFNCTILGKGGHGAMPHQTIDSIVVAAQVINALQTIVSRNIS
PIDSAVVTIGQLNAGRAFNVIANTARMAGTVRYFNLDYQNYFSKQMEQIISGICASYGAN
YELNYQPLYPPLINNPKVTDIVRSVAELIVETPAGVIPECQTMGAEDMSFFLQEVPGCYF
FLGSANSEKGLAYPHHHPRFDFDETALGIGVEMFIRCTEKFSIQE
Download sequence
Identical sequences Q114H5
WP_011611474.1.43450 gi|113475511|ref|YP_721572.1| 203124.Tery_1843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]