SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475536|ref|YP_721597.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475536|ref|YP_721597.1|
Domain Number 1 Region: 260-335,370-418
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000023
Family BAR domain 0.035
Further Details:      
 
Weak hits

Sequence:  gi|113475536|ref|YP_721597.1|
Domain Number - Region: 28-91,192-237
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0445
Family Calcium ATPase, transmembrane domain M 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113475536|ref|YP_721597.1|
Sequence length 474
Comment MotA/TolQ/ExbB proton channel [Trichodesmium erythraeum IMS101]
Sequence
MKQILSRYKIASSSPQNLTKNPLFWLNSQIDFIFVLLLAILILIAFFRYTYSQGSTISNV
FNFLIHCLGIWGVVVTAIAIATVEINRAIANETKEQGEDGLRKKRKVDLSKLEENYLPAN
ITEPTLAMTRLFRHVCNEAKNLRFESSINIVEPYRDESLDSLFTITNIQKIALRAGIFGT
FIGLLEAIIQLSQIGSEVTPIEAIKNLSGALFISFSTTIAGLEVAILLGFLLMILRKRQE
KYFRDMESSVEVILLLARNADNDDQSRILGELAKVESVVEQLGKRFYENTQEIQRSISAV
LERIGEQTNEIQKGMEQIKQTKVDFDRFINEISEVQNNFIEEVKEIYSELSLKSFRDDIK
NGIVFAGQTISSKLDETENSIQQQTEHIDAGINTLSETNAKFADFLRQLDSSQVNFMRNI
ENSQYTFSMLEANAKLRTTINQAIQRMEEITYTMRTVNKSLNKPLLQRIKNIFN
Download sequence
Identical sequences Q114F0
203124.Tery_1868 gi|113475536|ref|YP_721597.1| WP_011611497.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]