SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475572|ref|YP_721633.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113475572|ref|YP_721633.1|
Domain Number - Region: 123-169
Classification Level Classification E-value
Superfamily AF1531-like 0.000575
Family AF1531-like 0.0098
Further Details:      
 
Domain Number - Region: 11-37
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.000811
Family Intein (protein splicing domain) 0.01
Further Details:      
 
Domain Number - Region: 272-349
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0288
Family Single strand DNA-binding domain, SSB 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475572|ref|YP_721633.1|
Sequence length 517
Comment DNA polymerase III subunit alpha [Trichodesmium erythraeum IMS101]
Sequence
MVKIVSRKLAKTENVYDIGVTKDHNFVLANGLIASNCFNKSHSTAYAYVAYQTAYLKANY
SLEYMAALLTANSGDQDKVQKYLANCQKFNIEVEPPNINQSEVDFTPLPKVATKEIKDKI
LVGLSAVKNVGEGAIEAILKARKEGGEFKSLADLCDRVNLNALNSRTLESLIKCGAFDKI
EANRHQLIKDLEGVMKWAQDRNKDRNIGQLSLFDNHIPGAKNSAFDSVPKSSPVSDFPAK
EKLEYEKEILGFYVSDHPLKYAQEQNQIQDAISIAQMKEKKSNSKIKLVVMLAGIKPHVT
KKGDPMAFIQVEDMTGQLDAVVFPKVYQEIKELLTENSLLVLKGKVDNKDDESQLLVESA
ETIEKVMADAVKQEEKPVTELDNYQNESRDEEIKKYQDIGKAEKPVEQLETQRNLRKTEL
SKTENSSAKQRQIIILELSVDKIPEDNSLFEQIQAILKEQSSGDEEKAKVAVGTLIFDDQ
RQQLVQFGREFWVEDGQTTINRFIGIGIEAKIIPFPY
Download sequence
Identical sequences Q114B4
WP_011611533.1.43450 gi|113475572|ref|YP_721633.1| 203124.Tery_1905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]