SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475637|ref|YP_721698.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475637|ref|YP_721698.1|
Domain Number 1 Region: 10-137
Classification Level Classification E-value
Superfamily beta-Roll 7.46e-29
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1260-1347
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000353
Family Collagen-binding domain 0.0049
Further Details:      
 
Domain Number 3 Region: 193-277
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000000942
Family Collagen-binding domain 0.0049
Further Details:      
 
Domain Number 4 Region: 650-746
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000051
Family Collagen-binding domain 0.0067
Further Details:      
 
Domain Number 5 Region: 756-865
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000353
Family Collagen-binding domain 0.0079
Further Details:      
 
Domain Number 6 Region: 1385-1469
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000523
Family Collagen-binding domain 0.013
Further Details:      
 
Domain Number 7 Region: 1498-1592
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000837
Family Collagen-binding domain 0.0052
Further Details:      
 
Domain Number 8 Region: 1024-1107
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000183
Family Collagen-binding domain 0.0061
Further Details:      
 
Domain Number 9 Region: 1142-1223
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000144
Family Collagen-binding domain 0.016
Further Details:      
 
Domain Number 10 Region: 901-981
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000235
Family Collagen-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|113475637|ref|YP_721698.1|
Domain Number - Region: 290-336
Classification Level Classification E-value
Superfamily beta-Roll 0.000541
Family Serralysin-like metalloprotease, C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475637|ref|YP_721698.1|
Sequence length 1594
Comment peptidase-like protein [Trichodesmium erythraeum IMS101]
Sequence
MPTCTGVDWSGTPGDNVWPLSEDNSCNDTLNGRGGDDKLYASQGNDILYGGDGDDKLYGQ
QGNDKLYGEQGNDRLYGNGGRDRLYGNGGCDRLHGGRGKDTLNGGAGNDTLNGGAGKDKV
WKEEKDRVVPGDSDVIFLLTSTGKGHKKKISKNSSPVLRNPGGSKNTIADAFDLELIELG
PTVIEDKIGFRVNSQLDRNDYYKFTLDEESDFNLTLENLSANADVEILDSDGSTLLFSSA
NSGNTDELINAELDAGEYFIRVLPRGGAETDYRLTINAEPKNSSALLDSADLFIGGEGAD
KFVPFYDQDGTYGHDTIEDFNKSEGDKILLNGKNFEALKDITIGETLPEYEFIAIPNYGC
RGNTPQTSETIIYDPVSGLVYANQTEKPNDEVILTQLTNKSSLENTDFEIVDSETIIPPN
DPPMDCTSTGRPDRSFERGFQVEFSGTWGEAEPGPNPNPKTYPTDPPNTFRWGESVEEDL
KPNSLLFNAEDISGGIETDKQFEVGKLTFFNGSIFSDTAVESVPLEIKLELDTLEGEPPI
NKTFTFNLDLDTTEDTSDEIDDWSDFVYFPKVLPTETFKFNGQTYTLELTGFSQDGGDTL
ENRFRVMEQEVDIASLFAKIRLAPKDIERLEDPTAKPDGAINLGDLNSRKNYRNTDEIGF
NEGGVRDLQDFYKFTLSKDSEVDITLDQLKRNANVEILDEDGSTVLFQSTEENRKRENIT
ENLESGDYFIRVYPEGDDRTKYRLGVSADALTDEKDTTDTAKELGNIGLEEVTEIDRIGF
GRGKNRDQEDYYKFGINEKSDFFLTLDQLKGNANVEVLDGDGSTILYQSNNSGRKREKIN
EELEPGDYFVRVTPQGAARTDYRLGLSADVLSNEQDDQEPGISLGAVTELTPVSKTGKLG
ANKDRVDWYNFSVPIESDVNLTLDRLRQDLNVEIYDDGGELVDEGKKTGRKAEKIELEGL
EPGTYNIKVFPNGGAKSNYRLGITATAPYVDDYASVKEALDFGNIPIGETRVFNDEMGRT
EGRSGRDTEDWVSFTIDEESLVDIDLTRLRQNIDMILYDDDGTTTLNNSRNKGRKSENIA
EILEEGTYHVQILPKGNSRSNYRFSVNAEPIPEPRQEFTVGDLLSLEDGYSIRGEKIGFT
SSGVRNLIDRHLFSISDERNVEIDLTGLKRNANIALYDDDGTLLLESRKGGRKNENISDT
LDPGDYYVDVEPQNLAKTKYNLDIFASGSSVDPDGGPVPETSLYNDIGNLTEDYSKIDNV
GFGSGSSRDEVDYYKFELSEDKNLTISLNKLSADIDLELLDSSGTLIKDSRNKKKKNEKI
EEELEPGTYYVGVEPKGNARGNYTLNIKVPEPGSSVDEDGGKPPENVTDIGVLTSYEEED
SIGRREKSYRDVNDYRKFTLSAESSVDINLTDLKGNANLQLIDSDGSTVLNTSANGGRKD
ENINLTLEADDYYVRVFPRGAAKTNYSLNMSASEIGESIDNEPPGIALGTVTVGADPLTQ
GGDLGFTEGGVVDTKDYYSFDITQAGFVEIKLDDLNDNADLKLYDETGEVEIGSYTNSGN
TPEEIFTFISADTTYVVGVFGLGNQTFYDLSISL
Download sequence
Identical sequences Q113U9
WP_011611598.1.43450 gi|113475637|ref|YP_721698.1| 203124.Tery_1974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]