SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475732|ref|YP_721793.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475732|ref|YP_721793.1|
Domain Number 1 Region: 6-162
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.95e-36
Family HD domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475732|ref|YP_721793.1|
Sequence length 196
Comment metal dependent phosphohydrolase [Trichodesmium erythraeum IMS101]
Sequence
MMLSLHFTQALVYAAELHADQVRKGSKVPYISHLLGVASIALEYGADEDEAIAALLHDAI
EDQGGETVRGEIRARFGERVTEIVDGCTETDITPKPPWAERKKAYIARLANASPSVRLVS
LADKLHNVRSILKDYRTQGDVLWNIFKGGKEGTLWYYRSLVTAFHQAGSTPMVVELDRLV
TELEGLVEIDMAPTVG
Download sequence
Identical sequences Q113K4
203124.Tery_2079 gi|113475732|ref|YP_721793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]