SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475896|ref|YP_721957.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475896|ref|YP_721957.1|
Domain Number 1 Region: 263-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.09e-37
Family Leech intramolecular trans-sialidase, N-terminal domain 0.051
Further Details:      
 
Domain Number 2 Region: 486-703
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.41e-37
Family Leech intramolecular trans-sialidase, N-terminal domain 0.051
Further Details:      
 
Domain Number 3 Region: 708-925
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-36
Family Leech intramolecular trans-sialidase, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113475896|ref|YP_721957.1|
Sequence length 1374
Comment hypothetical protein Tery_2255 [Trichodesmium erythraeum IMS101]
Sequence
MSKVATKNITFWNTTGYNYPGFGKTVEVPDGLGGTISITYNQIDYNDRNWKAKPDGSVPV
TENRFLSGEVGNNFSLTGQVQGITATMPLIRTLGAENNYSVTLDFSKYKASAGGSKATDG
ATSGDTYLAISRFFNGSKTGYTTIKVTARTLDGSELNLGDWKLFNSGTLGQGNNARIFLN
AATQILSGKNSQGKPEFCPTPPNPNSSLGKGTGLGLFELASNQRYVSITLSFKQKKITGS
LPNDLHDIYVASNTSSTSPIDVTPPPMDINRGLQVHLPLNEIVKNAESKKEVVDISGAQV
NGKVNGAKVVADSKFGHCLSFDGVDDYLELPTATIPQTGAITISFWANGDNSLPKDNSII
AAYDQSNNRVINIHLPWNNSYIYFDCGNTGNSYDRIEKLAKAADFKGKWTHWVFTKNVTT
GEMKIYLNGALWSSGKDKSKQISGMTLVKLGSGYGFYHGQVAHLRIYDRVLSAEEINECM
KVDVTPPPMDINRGLQVHLPLNEIVKNAKSKKEVVDISGAQLNGKVNGAKVVADSKFGHC
LSFDGVDDYLELPTATIPQTGAITISFWANGDNSLPKDNSIIAAYDQSNNRVINIHLPWN
NSYIYFDCGNTGNSYDRIEKLAKAADFKGKWTHWVFTKNVTTGEMKIYLNGALWSSGKDK
SKQISGMTLVKLGSGYGFYHGQVAHLRIYDRVLSAEEINECMKVDVTPPPMDINRGLQVH
LPLNEIVKNAKSKKEVVDISGAQLNGKVNGAKVVADSKFGHCLSFDGADDYLELPTATIP
QTGAITISFWANGDNSLPKDNSIIAAYDQSNNRVINIHLPWNNSYIYFDCGNTGNSYDRI
EKLAKAADFKGKWTHWVFTKNVTTGEMKIYLNGALWSSGKDKSKQISGMTLVKLGSGYGF
YHGQVAHLRIYDRVLSTEEINECMKVDGTDATSTTDETDTISTNDVTDVTPTTDGTDTTS
TTDGTDTTPTTGGTDTTPTTSETDTTPTTDGTDTTLTTDRTGTTSTTDITDATSTTDGTG
TTSTTDGTDTTPTTDGTDTTLTTGGNDTTSTNDVTDATSTTDGTGTTSTTGGNDTASTND
VTVTTPTTDGTDTTLTTDGTVTTPTTDGTGTTSTTDGTVTTSTTGGTDTTPTTDGTDTTL
TTDGTDTTLTTDRTGTTSTTDITDATSTTDGTGNTSTTDGTGTTSTTDGTDTTLTTGGND
TTSTTGGNDTTSTTGGNDTASTTGGNDTTPTTDGTDTTSTTGGTDTISTTDGTDTTLTTG
GNDTTSTSDVTDATSTTDSTDTTQKPMEYQIYQVKGNPTIKTGYQGSEWTAVIAGFNCGA
KKKHKATAFTIMPVLDDGEWKIKCDIKDVDDRYWDVAVLFIRNNMVNMLNHFHR
Download sequence
Identical sequences Q112U0
203124.Tery_2255 WP_011611852.1.43450 gi|113475896|ref|YP_721957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]