SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476167|ref|YP_722228.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476167|ref|YP_722228.1|
Domain Number 1 Region: 574-641,1316-1460,1507-1620
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-47
Family RecA protein-like (ATPase-domain) 0.077
Further Details:      
 
Domain Number 2 Region: 6-105
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000128
Family Chondroitinase B 0.088
Further Details:      
 
Domain Number 3 Region: 592-638,743-887
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000876
Family RecA protein-like (ATPase-domain) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476167|ref|YP_722228.1|
Sequence length 1653
Comment superfamily I DNA/RNA helicase [Trichodesmium erythraeum IMS101]
Sequence
MTIFQTNPSNLHQLLQMVKDGDELNLQAGDYKAPFTIDKSITIRGSGSDTVIFAATETPL
IITASKVRVENLTVERTVGGDNGEVAIFAEANTNPILSQVKLNGVAENVEWSGVSWNIPT
ILDFGEIEINRLVEREWELELGSACQVLCDLNWLQVRSSYLSPGRQNLQVVLNTANIPTG
TNLSGLIFLSAADSRRELEVTAKVISPLPVTPVLAASTKALPAKVLNSQDWGYRFSGSAA
DKLVRAQLGEAALKKYPEFPQRRAKAEALMSEILDGNSHLYYVRRQAPGREEGEEIWELT
MATDREEQEWEKTLKLRGAVNIDEDRVLKLLSVQLISQKAEKDEFSLALQIRLLPQHQYR
RGIPLGVVRSMGKMPFFGDRIPTEEQLPIWTTFVEIEQRIAEKRQFCLQFLSHNYGSAGR
KITFEIDVSSATIDGTAESAIDDLELRRRLFEAKNEDIQLFQTSPAGGDARDGEKLGAIA
TIDWKKGQVGVMLDSEIVEIISRGSYRIPSTGFLFFIASGDIAQVKRKRRALEDLQSGRC
QNPYLGDFFFDATCARAPKQVVKLQPQDLLLPAANVNQIAAVETVLASPDLALIQGPPGT
GKTTVIAEICYQVALRGGRTLIASQANLAVDNALSRLVHNPVIRAVRKGKAEKVQEEGEP
FLEHRVIDTWLKNTANDCESDLDERLQRVEILRNLLIESERFNAYVELEEVWVSQQQELS
DRQTILETSREVLASEVLQLETDTKELNFLMLGLDNLLNSAPNVNWQDEEVKSLLPRLQP
YSQEEKSVKDLVENVRLARNISRDIGWEIPALGAFGLATWFQENLAILLPEFYNGLAVAK
KVTLMMSELENLQQIYQQSHSKFEQLKKDIDNQDIVSENLQKNRQELESQKSQIDLVVSE
VGAWINIGKNRIFEELKKCWETDQDFQLDLIGLPESLIKLVNRKKLQLLPEYAQPLHSLP
DWERVEKALNAESNRGFQNIRGREHRFDNFLQIILSKPPIVLSERDYQKWQEYAIYFERY
SQLNQTSRQGLVEKIQHFFDENRSKYSLVWKADNMLNTLAEVTDKISNKILHHSREMLLP
MKRRNQKEILKNKEHLEEISELQKSYKQEREVVEEEGKNLHQKLEQKYQEFINKLTGIEV
QLEFNPEIHSLAKKYLESTPLEVLNDQSNFVAKVNSWENNLKQLEKIAPLFEPFTVLTDI
KNLLQNKLNTAQEKADKSQEELQSSETEINQIKTALQQEPSITLIEERDWWKSAWKKIPE
NIKPRVYETEIFAIEILQKIKLQLQNWQQELDTEKTYLNSHQKFIQDWIEKIKKPSEKDS
NDLRKIYLDNANVIGITCVQAASRSFAEEFNSFDVVIIDEVSKCTPPEILIPALKGKKLV
LVGDHRQLPPMLHNSTIEEIAEEMKSTKEELSFLEESLFKTHFDTATEKIKQMLTIQYRM
HPNIMGAINQFYQHRLQCGIIQPNEERAHNLGGEILQDNKHIIWVKMPHLESFIEQKEGT
SPFNEKEVDVIEKLCGEMEKSWRIKIAEGFPRKELGIITFYNAQLRLIDSRINPEKFPSL
HIRTGTVDRFQGMERQVIIVSMVRNNEEGKVGFAKKPERVNVAFSRAQELLVIVGCHGLF
TQHYGMVGNMYSEVSDVVRRQGGLIEFSDILGE
Download sequence
Identical sequences Q111R9
203124.Tery_2554 gi|113476167|ref|YP_722228.1| WP_011612117.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]