SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476196|ref|YP_722257.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476196|ref|YP_722257.1|
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000067
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476196|ref|YP_722257.1|
Sequence length 133
Comment 2-octaprenyl-6-methoxyphenyl hydroxylase [Trichodesmium erythraeum IMS101]
Sequence
MTKLDYDLVIVGGGIAGTALACALKNSGLKVALVETKLKCVAARKKLAYNLSLISGRILD
GIGVWQKILPKITTYRQISLSDGNYPHTVQFYPNYLAISGEKQTSKEGLGYVGEHQVMLT
VMQEFLADFEQFT
Download sequence
Identical sequences Q111P0
WP_011612146.1.43450 gi|113476196|ref|YP_722257.1| 203124.Tery_2587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]