SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476202|ref|YP_722263.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476202|ref|YP_722263.1|
Domain Number 1 Region: 5-377
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.02e-36
Family Galacturonase 0.045
Further Details:      
 
Domain Number 2 Region: 509-656
Classification Level Classification E-value
Superfamily beta-Roll 1.05e-26
Family Serralysin-like metalloprotease, C-terminal domain 0.00058
Further Details:      
 
Domain Number 3 Region: 733-869
Classification Level Classification E-value
Superfamily beta-Roll 3.92e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.00072
Further Details:      
 
Domain Number 4 Region: 1058-1187
Classification Level Classification E-value
Superfamily beta-Roll 1.31e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0012
Further Details:      
 
Domain Number 5 Region: 862-982
Classification Level Classification E-value
Superfamily beta-Roll 1.94e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 
Domain Number 6 Region: 988-1078
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000361
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 7 Region: 457-523
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000392
Family Serralysin-like metalloprotease, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476202|ref|YP_722263.1|
Sequence length 1197
Comment periplasmic protein TonB links inner and outer membranes-like [Trichodesmium erythraeum IMS101]
Sequence
MATIVVNTLDDENDGSLDQGTGNSLREAINLSNAGDTIIFADTIAGKTINLSNSELIINK
NLTIDGDENNRVTINAQGNSRVFNINDNNSTQQQVTIDGVVITGGKASGSGPNESDGGGI
FTNEALTLSNSVVTGNTASGGNADGGGIYINSIASADIINTTISNNTATDDGGGVVGFGN
TNITNSTINNNATLTSTGDGGGVYIVRTTNITNSTISGNTSSGEGGGVYVKDQRLSNATI
TNSTITNNQAPEGKGSGLATLGVQTTTVTSSIIAGNVNSDVNELTSGSNAIESGGNNLIG
TGNTAAKFNATSDITGVTNPGLDPLADNGGPTQTHALQNVSRAINAGSNLSNLDTDQRGA
GFSRVFNGVADIGAFEFGNPIPTPEPTPAPTPEPTPAPEPTPEPTPEPTPEPTPEPTPEP
TPEPTPEPTPEPTPEPTPEPTPEPTPEPTPEPTPEPNSGNDTLDGNGRNNSIDGGDGDDF
INGKGGNDELFGENGADTLLGDLGNDELFGGNGGDSLVGGPGRDLLDGGTGNDSLNGSSG
PDTLDGGAGEDNLVGGPDGDRLFGGPRNDTLDGGLGRDSLIGGNGNDSLMGGNSIDTIDG
GIGNDTIDGGRGPDVISGEDNADTFVLRSTYGNDQILDYVDGTDNFFLDGLAFKDLIIER
DPDNRKNTIIQTKVTGSTEILATLVDFTRTDKLTEADFESSTPTPTPTPTPTPTSTPTPT
PTPTPTTISPTINNDTLDGDDQNNEIKGLGGNDLISGKGGNDQLFGDDGADTLLGDDGKD
TLNGGVGNDKLDGGKDDDRLIGGAGNGADILLGGDGKDTLIGGAGNDKLDGGKDDDHLIG
GTGNDVYTINSRKDIIIERARQGNDHVMSSVTYNLSNNLERLTLLGKNNLTGRGNDRANI
IRGNSGNNNLEGKGGNDQLFGNNGADNLLGGDGKDTLIGGAGNDKLNGGKDDDRLIGGTG
DDVYTIDSTKDIIIERANQGNDHVRSLVTYNLNNNLEKLTLLGKNNIIGRGNDRANVIRG
NSGNNKLEGKGGNDQLFGNNGADNLLGGNGNDALNGGGGLDILNGGSGQDTLIGSSGRDT
LIGGLDADSLLGGSDVDTLNGGSGRDTLDGGRNPDRLTGGSDADSFVLRSGDGNDRILDY
VDGTDNFLLDSLTFEDLTIELDSTGNNTVIKTSTETLATLVGVTDITDLDNGDFVIV
Download sequence
Identical sequences Q111N4
gi|113476202|ref|YP_722263.1| 203124.Tery_2593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]