SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476251|ref|YP_722312.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476251|ref|YP_722312.1|
Domain Number 1 Region: 143-280
Classification Level Classification E-value
Superfamily Lipocalins 2.93e-37
Family All1756-like 0.0000106
Further Details:      
 
Domain Number 2 Region: 1-141
Classification Level Classification E-value
Superfamily Lipocalins 1.31e-31
Family All1756-like 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476251|ref|YP_722312.1|
Sequence length 282
Comment hypothetical protein Tery_2644 [Trichodesmium erythraeum IMS101]
Sequence
MKTQWENFLQNLGEWHGSFTKISDKLAILQDRPSILILEGLDDQNKRVRLTLRRFNSFVK
NPESKADEIVIEYNTTDQNILYFENGAFSRGIMKITPFSRCVTEFCLINKNRRLRLVEFF
NQDGNFDKLILIREKRAGTDALENPPLTVDDLLGKWQGEAITMYPDLREPNTYTTQMELN
IDNTGRLVQEITFGDQNPTIITSSAIIEGSILHFDQSSQPVKVLLLPDGASATLPVKVEL
RKPLFFELGWLVEPQLRQRIIRSYNDKGEWVSSTFVTEQKIQ
Download sequence
Identical sequences Q111I5
gi|113476251|ref|YP_722312.1| WP_011612201.1.43450 203124.Tery_2644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]