SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476259|ref|YP_722320.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476259|ref|YP_722320.1|
Domain Number 1 Region: 38-211
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.22e-71
Family HD domain 0.00000247
Further Details:      
 
Domain Number 2 Region: 200-417
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.13e-60
Family RelA/SpoT domain 0.0000172
Further Details:      
 
Domain Number 3 Region: 400-472
Classification Level Classification E-value
Superfamily TGS-like 5.01e-24
Family G domain-linked domain 0.031
Further Details:      
 
Domain Number 4 Region: 669-748
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000108
Family AF1403 N-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476259|ref|YP_722320.1|
Sequence length 750
Comment (p)ppGpp synthetase I SpoT/RelA [Trichodesmium erythraeum IMS101]
Sequence
MKTKTVTPKAQISCVIPDWLQECLDNRNKGNNVTSCSVDTALICRAFEFAYKLHEGQYRK
SGEPYICHPVAVAGLLKYLGGDSTMIAAGLLHDIVEDTDVKIEEIEEKFGSEVTLLVEGV
TKLSKFNFSNKTELQAENFRRMFLAMAKDIRVIVVKLADRLHNMRTLQHLPSHKQLSKAL
ETREIFAPLANRLGIGRIKWELEDLSFKYLEPNAYREIQELVADKRVDREARLLKMTENL
RQKLDRLGIECYDISGRPKHLYGIYRKMYLKQKEFHEVYDISGLRIIVEKREDCYRTLAI
VHDSYRPIPGRFKDYIGLPKPNRYQSLHTGVIGITGRPVEVQIRTVEMHHVAEYGIAAHW
KYKETGYSNTNVNITTEDEKFTWLRQLLEWQSDLKDDREYLETIKGDLFSEDVYAFTPKG
DVISLKHGSTPIDFAYRIHTEVGNHCTGAKVNERIVPLDTPLKNGDIVEILTHKNGHPSL
DWLNSVVTGGARNRIRQWYKRSHREEILARGRELLEKELGKKGFESLLKSEQMRLVSEKF
NYHNVDDLLAGLGYGEITLNLVVNRLRDAFREVTKVEENSDICSEKYLHKSTQISSPNNY
HPIAGVEGLMYHLAGCCNPIPGEPIIGAVTRINGISIHRQGCSNIENVPGERLVPVSWNN
ANENNGRPKTYPVNIYIEVIDRVGVLKDILSRLMDNNVNVKNAQVKTNPGHTAIINLCIE
VSDCQQFERSCTQIKNISDILNLRRVSQVE
Download sequence
Identical sequences Q111H7
203124.Tery_2653 WP_011612209.1.43450 gi|113476259|ref|YP_722320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]