SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476271|ref|YP_722332.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476271|ref|YP_722332.1|
Domain Number 1 Region: 593-706,736-758
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000175
Family HD domain 0.031
Further Details:      
 
Weak hits

Sequence:  gi|113476271|ref|YP_722332.1|
Domain Number - Region: 730-819
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 0.0244
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476271|ref|YP_722332.1|
Sequence length 836
Comment metal dependent phosphohydrolase [Trichodesmium erythraeum IMS101]
Sequence
MYLTRLIGILFKPQKKGQVSRWSTLATSPMLVILAIVSLTATMGQRYYNQPELKEGTIAP
QIIRVPQDDTVIDHKLTDERRKSARLGDITVFMIDQSVNRKVDKELEEILTVGNKARYMV
ANFPFVNTGILSTITQRYLRQVSQQKWQAIQKIVEEELQERPPGPESERNVSASSTQKTR
KVTNEKNDIIRPTSTDEELSKGKSILAGNQKNSSIVVSSRDKKVISELLTYRKKSLFENY
LKVLEEVSLARNFYKNAKKLLAQEQENEGYEVYDHTLLELYDSTWQKTQIGIKTVKDRML
AQGISPNFPKKKWVNAIKAQVVGVLPLETQDLAVNILKNILEPNLAKDQDETRKLVEKEA
QNVKPVQYKVRKNEVIVKTGEKINRKAFVLLDNFSLSRRRVNWRSLVVFVCIVSASVAIV
VIVGKKFQSCLRRRDHILLLLLSLSAPLLVALRIPWTSSLPAIGLLVGNFYGSTMGVTLV
GLISVVLPIGMDVDKIDWFASAVGGIVGSLVVEKMRSREEQALLGVGVGLTQGMVYLLTN
LIVRANPGLLWYAIIGPVGWQVLTGLIWGIVALGLSPYLEHLFDLITPIRLSELANPNRP
LLKRLASEAPGTFQHTLFVATLAEAAAREIGCNVELVRTGTLYHDIGKMHDPLGFIENQM
GGPNKHDEINDPWMSVEIIKKHVTEGLVMARRHRLPKAIQAFIPEHQGTMLIAFFYYQAK
QRSEKEEKVIEEELFRYAGPIPQSRETAIVMLADSCEAALRSLKDANHKDALQMVKKILR
ARWQDHQLVDSGLTRGEISSIAEIFVQVWEQYNHKRIAYPKGAINPNQVKTVKSSC
Download sequence
Identical sequences Q111G5
203124.Tery_2666 gi|113476271|ref|YP_722332.1| WP_011612221.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]