SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476429|ref|YP_722490.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476429|ref|YP_722490.1|
Domain Number 1 Region: 382-575
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.92e-68
Family Pyruvate oxidase and decarboxylase PP module 0.0000157
Further Details:      
 
Domain Number 2 Region: 199-374
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.89e-66
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000331
Further Details:      
 
Domain Number 3 Region: 11-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.2e-65
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476429|ref|YP_722490.1|
Sequence length 587
Comment acetolactate synthase 3 catalytic subunit [Trichodesmium erythraeum IMS101]
Sequence
MQLQTKVSIKQATGAFALIDSLKRHGVKHIFGYPGGAILPIYDELYRAEAAGDLQHILVR
HEQGASHAADGYARATGEVGVCFATSGPGATNLVTGIATAHMDSIPMVIITGQVGRPMIG
TDAFQETDIYGITLPIVKHSYVVRDPRDMARIVAEAFHIASTGRPGPVLIDIPKDVGLEE
FEYEPVEPDSITLPGYRPTIKGNPRQINQAINLIQEARRPLLYIGGGAISASAHGEIQEL
AERFNIPVTTTLMGKGAFNEHHPLSVGMLGMHGTAYANYAVSECDLLIAVGARFDDRVTG
KLDQFASYAKVIHIDIDPAEVGKNRSPEVPIVGDVRQVLIDMLERCQKIDTNVSSNQTQT
WLERIKRWKQDYPLVVPHYSDSMSPQEVIDQIGKMAPDAYYTTDIGQHQMWAAQFLKNGP
RQWVSSGGLGTMGYGMPAAIGVKVALPNREVICISGDSSIQMNIQELGTLAHYGINVKTV
IINNGWQGMVRQWQQAFFGERYSSSNMEVGMPDFVKLAEAYGVKGMMISHRDQLKEAIEE
MLAYDQPVLMDAHVTRDENCYPMVAPGKSNAQMIGLPIRKQLEQAVE
Download sequence
Identical sequences Q110Q7
gi|113476429|ref|YP_722490.1| 203124.Tery_2843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]