SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476604|ref|YP_722665.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476604|ref|YP_722665.1|
Domain Number 1 Region: 2-350
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.53e-75
Family TK-like PP module 0.014
Further Details:      
 
Domain Number 2 Region: 290-480
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.03e-63
Family TK-like Pyr module 0.011
Further Details:      
 
Domain Number 3 Region: 494-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.83e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476604|ref|YP_722665.1|
Sequence length 635
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Trichodesmium erythraeum IMS101]
Sequence
MHLSEITHPKQLHNLSIHQLEEIARQIREKHLETVATSGGHLGPGLGVVELTLGLYQTLN
LDRDKVIWDVGHQAYPHKIITGRYHNFHTLRQKDGIAGYLKRCESKFDHFGAGHASTSIS
AGLGMALARDMKGDNFKVVSIIGDGALTGGMALEAINHAGHLPKTNILVVLNDNEMSISP
NVGAISRYLNKMRLSPPIQFLQDNLEEQFKQIPFVGETFTPEMEGLKGGMKRLAVSKVGA
VIEELGFTYMGPVDGHNLEELITTFNQAHQIPGPVLVHVATTKGKGYPVAEEDKVSYHAQ
NPFNLATGKALPASKPKPPKYSKVFAHTLVKLAENNPKIIGITAAMATGTGLDKLHGKLP
KQYIDVGIAEQHAVTLAAGLASEGMRPVVCIYSTFLQRAYDQIIHDVCIQKLPVFFCLDR
AGIVGADGPTHQGMYDIAYLRCIPNMVVMAPKDEGELQRMVLTGIKHTDGAIAMRYPRGN
GYGVPLMEEGWEAITIGKGEILRNGDDVLILGYGSMVYSAMQTAEILSEHGVAATVVNAR
FVKPLDTELILPLAQRIGQVVTMEEGCLMGGFGSAVTEALMDNNVLVPVLRLGVPDKLVD
HAKPDESKADLGLTPSQMAERILQSFKPRLSTINV
Download sequence
Identical sequences Q10ZY2
WP_011612545.1.43450 gi|113476604|ref|YP_722665.1| 203124.Tery_3042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]