SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476735|ref|YP_722796.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113476735|ref|YP_722796.1|
Domain Number - Region: 6-52
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.00249
Family Zn-finger domain of Sec23/24 0.016
Further Details:      
 
Domain Number - Region: 49-112
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0143
Family Cgl2762-like 0.062
Further Details:      
 
Domain Number - Region: 135-156
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 0.019
Family Lactate & malate dehydrogenases, C-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476735|ref|YP_722796.1|
Sequence length 177
Comment insertion element protein, partial [Trichodesmium erythraeum IMS101]
Sequence
MSLTTVRDQPIQCPDCSCQHIPKNGHQPGKQNYICVACSHQFIKPYHPQEYSDNVKRLFL
RIYVNGMGIRRIAWVKGVTYPTIINLIKHTRECSPNAYDLDQLSQVGELHELETFVSDKK
NKVLLWTLVYHFRQGILGWVVGNHSGDTFQPLWQAIGFWKCYFQVTDGNPVASRLYP
Download sequence
Identical sequences Q10ZK1
203124.Tery_3201 gi|113476735|ref|YP_722796.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]