SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476790|ref|YP_722851.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476790|ref|YP_722851.1|
Domain Number 1 Region: 29-334,376-406
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.1e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.0058
Further Details:      
 
Domain Number 2 Region: 358-466
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000377
Family P22 tailspike protein 0.074
Further Details:      
 
Weak hits

Sequence:  gi|113476790|ref|YP_722851.1|
Domain Number - Region: 520-660
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476790|ref|YP_722851.1|
Sequence length 1349
Comment filamentous hemagglutinin outer membrane protein [Trichodesmium erythraeum IMS101]
Sequence
MLFFYKNLFLRIVPLSLTLGYFGVDISSAIAQLQPDNTLGEENSVVTPNINIKGIESDRI
DGGAQRGANLFHSFQEFNIQQGRGVYFSNPDGVQNILTRVTGNNGSNILGTLGVDGKADL
FFINPNGIIFGPEAKLDVQGSFYGATADSILFKNGFEFASSDPQAPPLLTVNVPIGLRLP
ENPGSILVEGQGHNINFYLNPKDGIARLEKEDRNLGLEVSQGQTLGLVGGDIFLRGGNLT
SIGGRVELGSVHNGVVGITKDQTLSYDPNLKFGQILISEESSIDVSGSGRVEFQIQGEEI
KVRDASIIVGEIKGDEGGGASILKASKSIIIEGRIPFENNITSSFNVSLFSDKLEAGEAL
NINKTNSAIILITYGKGNVGELTVETESLTLDPGAFISTTTLGQGNGGNLTVFAKDIEMN
GGDFFGGLVSVSVDQGNGGNLTVKAAESLTLQDGAIISTTTLSQGNAGNLTVSARDILIG
YSTMLSAETLGQGNGGNLTVKAAESLTLQDGAFISTKTSGQGNAGNLIVSARDIEIIGKS
PDGKSFSSLTAEAKKESTGAAGTITINTETLNLRNEAEIIVTSATQQAAGDLIINSNNIR
LENQASLKAETKAGEGSITINNNKDLILRNNSNITTNSEGTATGGNITINTENLVAPDNS
DISANAVEAFGGRVNITAAGIFGTEFRTEATDKSDITATSELGASFSGEVNINTPDVDPS
DGLIEFEDTVPDISNLLDQNPCRQGQKSKFIITGRGGLPPTLEEPLAPTYVWQDSETSVT
PPPAITPSEQEFIEAQGWSSNSQGIELITDPETATPTSPWLIPPNCEQLDTFEPPPYLLA
SSKGNIPTSTSEPLKVTIKQFNFEGNTKFSNQELQQQLTPYLNKPITFAQLIAARTAITK
YYTKNNYITSGAFIPPQTMAENGTVTLRVVEGKVGEINVNIQGRLNENYIKSRLEKATTA
PLNQEKLLSALQILQIDPLVKTLSAELSSGVRPDTSRLDIRIETANPWQIETISNNGRAP
SVGTFRRGVEVDHRNVTGIGDSLSALYTNTDGSDMVEVSYAIPVNSSNGRIELFYRHRDN
KVVESPFERLDIESNSNTYKLSFSQPIMQTPWQTLSLGLSAIKRDSQTSILGENYPLSEG
ADKNGETKLSILQLFQDYELRGKNQVLAFHSQLNVGLGILDATKNSNEPDGRFFYWRGQG
QWVRELGKNTLLLMGADLQLSPSDLVPQERFGLGGYRNVRAYRQDTRLTDNGALGTVELR
LPVPWISGKNRLFQVVPFIDGGVAWNSDSKEEEGSKALAAAGVGLQVNLWEKINMRLDYG
IPLVDVDSRDKTAQEEGFYFSFSTTPFSF
Download sequence
Identical sequences Q10ZE6
203124.Tery_3266 gi|113476790|ref|YP_722851.1| WP_011612723.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]