SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476794|ref|YP_722855.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476794|ref|YP_722855.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.42e-38
Family Ribosomal protein S14 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476794|ref|YP_722855.1|
Sequence length 100
Comment 30S ribosomal protein S14 [Trichodesmium erythraeum IMS101]
Sequence
MAKKSMIEREKKRKKLVEKYAEKRRELKEQFMKAEDLEQKIELHRQIQRLPRNSAPSRVR
NRCWLTGRPRGFYRDFGLSRNVIREMAHEGLLPGVVKSSW
Download sequence
Identical sequences Q10ZE2
2005473404 WP_011612727.1.43450 203124.Tery_3270 gi|113476794|ref|YP_722855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]