SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476862|ref|YP_722923.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476862|ref|YP_722923.1|
Domain Number 1 Region: 2-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.61e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00058
Further Details:      
 
Domain Number 2 Region: 334-448
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.15e-34
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476862|ref|YP_722923.1|
Sequence length 473
Comment pyridine nucleotide-disulfide oxidoreductase dimerisation subunit [Trichodesmium erythraeum IMS101]
Sequence
MAVKYDIVIIGGGSAGLVVASAAAQLKAKVALVERDKLGGDCLWFGCVPSKSLIHASRVA
YQVKNAARFGIYTQPPEIEFAKVTSHVQQVIANIQPHDSPERFRGLGVEVIFGEGEFIDQ
KTFEVNGQKLTARAFVISTGSRPAIPSFEGLNSADFLTNEKVFDLKQRPNNLAIIGAGPI
GCELGQAFSRLGSNVTIISSKSHILPKEEPEAALVVQKQFESEGINILKEVRAEKVEVVD
GKKQVTAGGKNIIVDEILFAGGRLPNVESLNLEVAGVEVGKQGIIVNEKLQTTNSKIYAC
GDVIGGYQFTHVAGYEAVVALTNALFFPISKVNYRVIPWATFTDPELARVGLTEQQAKER
YGDDVCVLKQPFSGVDRAQAEAATNGFCKIITKGNGEILGAHLVGISAGELIHEIVLAMS
NNLPVSALTGIHVYPTLSEVNSKAGLLLKKQKYAKNLSQQNLLEQFFNWRRSF
Download sequence
Identical sequences Q10Z74
203124.Tery_3348 gi|113476862|ref|YP_722923.1| WP_011612795.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]