SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476889|ref|YP_722950.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476889|ref|YP_722950.1|
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.1e-28
Family Universal stress protein-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113476889|ref|YP_722950.1|
Sequence length 136
Comment hypothetical protein Tery_3375 [Trichodesmium erythraeum IMS101]
Sequence
MFKTVLFPVDLSREAREAGDKVINIVKTYQSRLVLVSVVEVVSEGQKPFHPEMTSSETVN
QLLEETKSIFTQQGIEPETLQKEGHPAFTICDVADEIEADLIVIGCRGTGLSDGGNNDSI
SNRIINLSPCPILVVP
Download sequence
Identical sequences Q10Z47
WP_011612822.1.43450 gi|113476889|ref|YP_722950.1| 203124.Tery_3375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]