SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476944|ref|YP_723005.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476944|ref|YP_723005.1|
Domain Number 1 Region: 21-107,151-378
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.09e-36
Family Pancreatic carboxypeptidases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476944|ref|YP_723005.1|
Sequence length 381
Comment succinylglutamate desuccinylase/aspartoacylase [Trichodesmium erythraeum IMS101]
Sequence
MKPKIYTIPLRQFASGDFLYLQVYKFIGNQAGKKAYIQANLHGAEISGNAVIYHLIEFLM
NLDNNQLIGEIWLVPVCNPEGVNVRSHQFSSGRYNSYDGKDWNRIFWDYEKENVDIEAFA
KAQINLSETEIKNNYRQEILRSFNQQLEKINSPSSTPFYKQYRYQLQSLCLDADYVIDLH
SSSNQSLDYFYCFHGREESAKSFLFDYGILVLEGEYEGNTFDEGFLKPWLALERHLKKLG
KPIQFDIESWTLELGSGMKMNPESVTKGIRGLKNYLANKKLLKIPEFPLKELADHQIVFT
TRQEMKPYYAPVGGMIQNRMEPGTIVKKNQRLYQILNFNKNQDLPKVVDVFAQTDGLILD
NSTNHCVNQGDFVLEIIREKL
Download sequence
Identical sequences Q10YZ2
gi|113476944|ref|YP_723005.1| WP_011612875.1.43450 203124.Tery_3439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]