SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476989|ref|YP_723050.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476989|ref|YP_723050.1|
Domain Number 1 Region: 25-191,222-348
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.91e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.0054
Further Details:      
 
Domain Number 2 Region: 598-774
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000565
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 3 Region: 468-653
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000471
Family Filamentous hemagglutinin FhaB, secretion domain 0.089
Further Details:      
 
Domain Number 4 Region: 369-469
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000502
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Weak hits

Sequence:  gi|113476989|ref|YP_723050.1|
Domain Number - Region: 776-888
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00091
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113476989|ref|YP_723050.1|
Sequence length 1570
Comment filamentous hemagglutinin outer membrane protein [Trichodesmium erythraeum IMS101]
Sequence
MNRCLMAFPFLSIAFPFLSVCTFLVFSPFALAQLLPDNTLGEENSVVTPNNIKGKDRIII
DGGAQRGANLFHSFQEFNIQQGRGVYFSNPDGVQNILTRVTGNKASQIFGTLGVDGKADL
FFINPNGIIFGPEAKLDVQGSFFGATADSILFNNGFEFASSDPQAPPLLTVNVPIGLRLP
ENPGSILVEGLGHNINMSEYLETIFDGKEKGPRDGKEDRNLGLEVSQGQTLGLVGGDIFL
RGGNLTSIGGRVELGSVHNGVVGIRKDQTLSYDPNLKFGQIQISKESSIDVSGNGRVEFQ
IQGEEIKVRDASIITGEIKGEGEGEGEKGGNSIIKASKSIKIEAGEYSELTLRLTSDKLP
KQDFNFNKTYSAIILSTFGKRDVGELKVETESLTLQDGAFISTTTSGQGNAGNITVSARD
IEMNGGGDGATLVTMTFAFAKGNAGNLTLKAAESLTLHDAIISTGSFGSAQGNTGKLTVS
ANAIEINAVASEGAGFFSERGSGKGKGGNLTVKAAESLTLVGNGFISTSTFGDGDAGNLT
VSARDIEMSGTSRMAAQTGTRQTGGKGKGGTLMVKAAESLTLQDKAFISTDTKGDGDAGN
LTVSARDIEMNSVFGLLAQTENKGNGGNLTVKAAESLTLVGNGVISTSAFGDGDAGNLTV
SARDIEMSGKSRMVAQTGRRQTGGKGKGGTLMVKAAESLTLQDEAFISTTTFGDGDAGNL
TVSARDIEMSSIFGSGVFAQTENKGNGGNLTVEVAESLTLQDGAIISTRSLGDGDAGNIT
ISARDIEIIGTSPDGKYFSSLTAEGRAKGAAGSITINSNNIRLENQANLKAETQAGGEGS
IIINNNKDLILRNKSKITTSAKGRATGGNITIKTENLVAPDNSDISADAEKASGGQVDIT
AAGIFGIKFRPEKTERSDITVTSEFDRDGEVNINTPDVDPSDGLVEFDDTIPDISNLLDQ
NPCRKGQNSKFIITGRGGLPPTLEDPFTPTHIWQGSETSVTPPKAITPSEQEFIEAQGWI
SNSQGIELITNPETATPTSPWLIPPNCKQLDAFEPPPYLLASSKGNIPTSTSEPLKVTIK
QFNFEGNTKFSNQELQQQLTPYLNKPITFAQLIAARTAITKYYTKNNYITSGAFIPPQTM
SDNGTVTLRVVEGKVGEINVNIQGRLNENYIKSRLEKATTAPLNQEKLVSALQLLQIDPL
VKTISAELSSGVRPDTSRLDIRIETANPWQIETISNNGRAPSVGTFRRGVEVGHRNVTGI
GDSLNALYTNTDGSDMVEVSYAIPVNSSNGRIELFYRHRDNKVVESPFERLDIESNSNTY
KLSFSQPIMQTPWQTLTLGLSAIKRDSQTSILGENYPLSEGADENGETKLSILQLFQDYE
LRGKNQVLAFNSQLNVGLGILDATKNSSEPDSRFLYWRGQGQWVRELAKNTLLVVGADLQ
LSPFDLVPKEQFGLGGYRSVRAYRQDTRLTDNGALGTVELRLPLPWISGKNRLFQVVPFI
DGGVAWNSDDEEVEGSKALAAAGVGLQVNLWEKINMRLDYGIPLVDVDSPDKTAQEEGFY
FSFSTTPFSF
Download sequence
Identical sequences Q10YU7
203124.Tery_3487 WP_011612919.1.43450 gi|113476989|ref|YP_723050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]