SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476991|ref|YP_723052.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476991|ref|YP_723052.1|
Domain Number 1 Region: 78-209,237-383
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.95e-36
Family Filamentous hemagglutinin FhaB, secretion domain 0.0058
Further Details:      
 
Domain Number 2 Region: 502-647,683-708
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.039
Further Details:      
 
Domain Number 3 Region: 403-508
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476991|ref|YP_723052.1|
Sequence length 1391
Comment filamentous hemagglutinin outer membrane protein [Trichodesmium erythraeum IMS101]
Sequence
MNFYFVVTRQYLLKSHTNFTITLRRKSSTINRYLRTESLNSEDLWRNLTLSVFLLFGFFS
PSALAFFIHFLLFGFFSPSALAQLQPDNTLGEENSVVTPNINIKGIESDRIDGGAQRGAN
LFHSFQEFNIQQGRGVYFSNPDGVQNILTRVTGNNGSNILGTLGVDGKADLFFINPNGII
FGPEAKLDVQGSFYGATADSILFKNGFEFASSDPQAPPLLTVNVPIGLRLPEKPGSILVE
GQGHNINMSEYLETYGYRNRKEDRNLGLEVSQGQTLGLVGGDIFLRGGNLTSDGGRVELG
SVQNGVVEITTDRTLSYDKNLEFGQIILSEASSIDISGNGRVEFQIQGEEINVQDNSLIL
GKILGDEDGGNSIIRASKSIKIGPTKPFEKIPVKIKIVNFTYTFNKTMSSIFLNTYGKGD
VGELRVKTESLTLQDGAVIYTGTVGQGNAGNLTVSARDIEINGGNYATGFFPTTLAEGNG
GNLTVEVAESLTLQDGAVMSAGTGYQGNAGNLTVSARDIEMSGFVVVTTITETTGNGGNL
TVEVAESLTLQDGAVMSAGTVGQGNAGNLIVSATDIEIIGKSPDGKSFSRLTAEATNEST
GAAGTITINTETLNLRNEAEIIVTSATQQAAGDLIINSNNIRIENQASLKAETKGGQGSI
TINNNKDLILRNNSNITTNSEGTATGGNITINTENLVARDNSDITANAVEGFGGRVNITA
AGIFGTEFRPEQTEKSDITATSKLGASFSGEVNINTPDVDPSDGLVEFEDTIPDISNLLD
QNPCRQGQKSKFIITGRGGLPPTLEEPLAPTYLWQDSETSVTPPPAITPSEQEFIEAQGW
ISNSQGIELITDPETATPTSPWLIPPNCEQLDTFEPPPYLLASSKGNIPTSTSEPLKVTI
KQFNFEGNTKFSNQELQQQLTPYLNKPITFAQLIAARTAITKFYTKNNYITSGAFIPPQT
MAENGTVTLRVVEGKVGEINVNIQGRLNENYIKSRLEKATTAPLNQEKLLSALQILQIDP
LVKTLSAELSSGVRPDTSRLDIRIETANPWQIETISNNGRAPSVGTFRRGVEVGHRNVTG
IGDSLSALYTNTDGSDMVEVSYAIPVNSSNGRIELFYRHRDNKVVESPFERLDIESNSNT
YKLSFSQPIMQTPWQTLSLGLSAIKRDSQTSILGENYPLSEGADENGETKLSILQLFQDY
ELRGKNQVLAFNSQLNVGLGILDATKNSNEPDGRFFYWRGQGQWVRELGKNTLLVMGADL
QLSPSDLVPKERFGLGGYRSVRAYRQDTRLTDNGALGTVELRLPVPWISGKNRLFQVVPF
IDGGVAWNSDGKEEEGSKALAAAGVGLQVNLWEKINMRLDYGIPLVDVDSLDKTAQEEGF
YFSFSTTPFSF
Download sequence
Identical sequences Q10YU5
WP_011612921.1.43450 203124.Tery_3489 gi|113476991|ref|YP_723052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]