SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477163|ref|YP_723224.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477163|ref|YP_723224.1|
Domain Number 1 Region: 3-199,300-391
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6e-85
Family Bacterial dinuclear zinc exopeptidases 0.0000255
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.2e-29
Family Bacterial exopeptidase dimerisation domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113477163|ref|YP_723224.1|
Sequence length 400
Comment amidohydrolase [Trichodesmium erythraeum IMS101]
Sequence
MLNKIKELATTLAPRLIEIRRHIHSHPELSGQEHQTAAYVAGVLSSCGLHVREAVGKTGI
VGELKGSTNNNQWLAIRTDMDGLPIKECTNLDFASRNTGVMHACGHDIHTTVGLGTAMVL
SELGELLPGDVRFLFQPAEEISQGANWMIKDGVLENVEAILGVHVYPSILAGSVGIRHGA
LTAAADDLELTIIGESGHGARPHEATDAIWISSQIITNLQQAISRTHNPLRPVVLTIGKI
SGGRAPNVIADQVKMSGTVRSLHPDTHKTLPAWIENIVANICNSYGAKYELNYRQGVPSV
QNNPVLTQLVESVALEAWGSDRVIVLPEPSLGAEDFSMYLQKVPGMMFRLGVGYKDKYNY
PLHHPQFEVDESSIVTCVVVLAYAAYKYWHNHTKVTTTDS
Download sequence
Identical sequences Q10YC3
203124.Tery_3690 gi|113477163|ref|YP_723224.1| WP_011613083.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]