SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477173|ref|YP_723234.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477173|ref|YP_723234.1|
Domain Number 1 Region: 23-128,171-225
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000733
Family Heat shock protein 90, HSP90, N-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477173|ref|YP_723234.1|
Sequence length 244
Comment hypothetical protein Tery_3702 [Trichodesmium erythraeum IMS101]
Sequence
MSESIKAQYPIISYNHILSELSVNSQDPCEVIRELISNSYDAEASQIQIYPITTEREKGF
IFFDDGIGLNETEETNGITPYRAFFSIGKSTKVQGDYIGYKCQGSKLCFASKKITIITKC
SGEPSWRYISIDNPQKNINESFNISSQHSDQPWSILSKLFPILKSSTKNILEKLDKDFFD
RNFKSQGTMIILEGLHIANFNKFYSTDEYARDDWSYLKHYIRFNTRHGDMRILRPDKTGF
PQRK
Download sequence
Identical sequences Q10YB3
203124.Tery_3702 WP_011613093.1.43450 gi|113477173|ref|YP_723234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]