SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477181|ref|YP_723242.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477181|ref|YP_723242.1|
Domain Number 1 Region: 62-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.6e-51
Family Prokaryotic proteases 0.0000377
Further Details:      
 
Weak hits

Sequence:  gi|113477181|ref|YP_723242.1|
Domain Number - Region: 291-374
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00235
Family Collagen-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113477181|ref|YP_723242.1|
Sequence length 394
Comment peptidase S1 and S6, chymotrypsin/Hap [Trichodesmium erythraeum IMS101]
Sequence
MKVKFLQKATSRILALGIGVSVNFTNFSVVNAQIRADKTIKIRYKNQIESIFVQSIEEQT
NIRVYQQTNQAVVSIDTDKANGSGTIISRDGMVLTNAHVVSQGGIVKITLADGRKVEADV
IGFGEKGLDLAVLKIRGETNLPTIRIASSGDIKVGQRAFAIGNPFGRFQGTLTVGIVSRI
DEERGLIQTDAAINPGNSGGPLLNSAGELIGVNTAILTPSQLGGNIGIGFAISIDKVPEL
LKAVRERRAPLVAQHSRSRMFDEDFAKKLDFDALIEVQGNLDGESNVLPVDNSYYDLYAF
KGRAGQKISIDMSSNQIDSYLILLNSEDQELAQDDDSGEDKNARIIIILPKDGTYKLLAN
SYEAGESGKYELKIEAISPKMRILFEQEKSNFYR
Download sequence
Identical sequences Q10YA5
WP_011613100.1.43450 gi|113477181|ref|YP_723242.1| 203124.Tery_3710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]