SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477280|ref|YP_723341.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477280|ref|YP_723341.1|
Domain Number 1 Region: 10-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00045
Further Details:      
 
Domain Number 2 Region: 287-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477280|ref|YP_723341.1|
Sequence length 493
Comment putative flavin-binding monooxygenase [Trichodesmium erythraeum IMS101]
Sequence
MNNQISSNPDQNLEIAIIGAGISGLCMAINLRKAGITTFKIFEKSDNVGGTWHDNTYPSC
GCDTPSILYSFSFEPKSDWTRHFPKQPEILEYLEHCSKKYDIRKHITFNTEISSAFFDSE
KNIWRIYSASGEEFSANILVSGCGQLNKPKIPHLDGLETFSGTQFHCARWNHEHDLKDET
VAVIGTGASAIQFIPIIAEQVKKLIVFQRSAPWIAPKPDFKFTNFIHWLGKSFPFILRFY
RWLLYLVLEYFVVYLTIKQNTIVGKLVSTFLNFQREKIIKDENLKSILKPNYEVGCKRIL
ISNDYYPALQLPNVEVVAQDIKGINQNQIITKEGREYPVDTLIFATGFDTKLLSSIKIVG
LNNQLLQDKWQDGAEAYKGIMIPEFPNLFMLYGPNTNTGTQSIIFMVECQVNYIISCIKM
MQNKSQKYLDVKPDINSEYNQKLQVAASQTVWNSGCSSWYKTKTGKIVNNWPFSTVRYWL
TTSQADPKDFNFS
Download sequence
Identical sequences Q10Y06
203124.Tery_3824 WP_011613198.1.43450 gi|113477280|ref|YP_723341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]