SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477379|ref|YP_723440.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477379|ref|YP_723440.1|
Domain Number 1 Region: 211-548
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.18e-54
Family Integrin alpha N-terminal domain 0.0065
Further Details:      
 
Domain Number 2 Region: 557-667
Classification Level Classification E-value
Superfamily CalX-like 7.72e-30
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 3 Region: 670-781
Classification Level Classification E-value
Superfamily CalX-like 2.22e-29
Family CalX-beta domain 0.00087
Further Details:      
 
Domain Number 4 Region: 786-892
Classification Level Classification E-value
Superfamily CalX-like 1.83e-23
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 5 Region: 895-1007
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000314
Family Collagen-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113477379|ref|YP_723440.1|
Sequence length 1009
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
Sequence
MTDDSEFLDIMSDLELKHINNIPPITFLGQVSVEVLPAVEIIEEGLAQFQENLTNFAASE
TFEADMLNVFGESGKVDLGKTIVDTLAKGENLPQINIVPVELMNGAAGGFDSLTGMVYLT
DSLINENSVIGSETRQFPHLTDVLAEELGHYIDSKLNTIDTPGDEGEWFAALVRGDVLSV
EEVEGLRGEDDMVKILNGLVEVEASSELSFKISNFPTGDQPFGMAVADFDKDGFKDIVAA
NVGSTTVSVLFGDGKGGALTATTHEVGGKPVYAAVGDFNRDRNPDIATTNQDDDTVAVLL
GDGKGRFSSPSEFPVGDGPSQLAVADVNQDRKLDIVTGNSGSDNVSVLLGSGNGSFAESI
SYQVGADLPANLVVKDFNGDGKLDIVTANGNSNNVSVLLGNRDGGFDFLTSFIAGGDTPS
GIVAKDVNGDKKQDIVINMEDSDKVSVLFGLGDGRFGFPNSFPVGNSPEDIAIGDLNGDR
KLDIVTVNRESNNISILPGQGKGSFGSAINFQVGDAPEDVVVEDFNADGKLDIATTNGAS
DTISILLNTTKMAIFPNIAISDTKITEGDKGRKNAKFTVTLDNESDQTVKVNYATANKTA
KGNEDYKPTKGTLTFKPGETQKNITVPILGDNKVEPNETFNLNLSKPKNARLKDKVGLGT
ITNDDKKNPPQISISDTKIVEGNRGRKNAKFTVTLDAKPIETVQVDYGTRNQTAKANQDY
KPTKGTLTFRPGQTRKTITVPIFGDNKIENDETFQLNLSKPRNAQLKDRRGIGTIRNNDL
PKLFIKDREITEGDDGKKQLTFDVTLNAKTQKRVEVSYATADGTAKEGSDYQKTQGKLIF
QPNQKKKTVTVPILGDLSEESSENFTVNLRKPKNARLGDKGAIGTIKDNDRGGEQPGESF
QTAINLGQFTGEVVRTDEVGFSRGIYRNTNDFYTFQTDKESAFVLFLDNLLQDANIGLYG
SEEEVINQSKNSGIERESIVTTLDPGTYYVRVYPQGASRTDYRLSLNLL
Download sequence
Identical sequences Q10XQ7
gi|113477379|ref|YP_723440.1| 203124.Tery_3936 WP_011613297.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]