SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477463|ref|YP_723524.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477463|ref|YP_723524.1|
Domain Number 1 Region: 454-631
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.2e-43
Family N-acetylmuramoyl-L-alanine amidase-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113477463|ref|YP_723524.1|
Sequence length 636
Comment cell wall hydrolase/autolysin [Trichodesmium erythraeum IMS101]
Sequence
MGNFNPLLMVIRKAINFQVFRKIISLSTLELIIFLGLINIISPNAMSQNYEDNNQLPQDS
KSRKKSLFIAYPSPNHKTTSDRIFLIGTASPEAEVTVNGKLINERSRMGHFAPTFPLQIG
ENIFTVQHQNEEIILKITRNSNQPPLPVGVAFTQDSLTPIKDIARMPGELICFQAIAPPN
ANISVLLATQTIPLFAQSQIVNLPGNLAVLTGDNQPFPSGGDYYQGCTKVETPGELGQPE
FQLSLMGKTVTQKAPGKVSILSPTTFEIAEVTVEEGVARTGPSTTYSRLTPLPKGTKALI
TGKEGDYLRLDYGGWIKANETRIFTDATPPRSVIRSAIARQVQGATEIRFPLQVPVPVTV
EQGARYLSLTLHNTTAQTDTIRLDDDPLIERLDWQPVLTSTVQNEQAVRYKFNLKTDQQW
GYKLQYVGTTLLLTLRHPPAVKSVISSATQPLTGMKILIDAGHGSENDLGAIGPTGYPEK
NVTLIISKLLQNELINRGALVYMTRKAEEDLYPKDRVEMINQQVPDLALSVHYNALPDYG
DALKTQGIGTFWYHSQAHSLAIFLHNYLVEKLDRPSYGVFWNNLALTRPAIAPSVLLELG
FMINPYEFEWIMNSQEQQKLAKALADGIVEWVKKSQ
Download sequence
Identical sequences Q10XH3
gi|113477463|ref|YP_723524.1| 203124.Tery_4034 WP_011613381.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]