SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477498|ref|YP_723559.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477498|ref|YP_723559.1|
Domain Number 1 Region: 7-187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.67e-37
Family Pyruvate oxidase and decarboxylase Pyr module 0.0042
Further Details:      
 
Domain Number 2 Region: 397-566
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.84e-22
Family Pyruvate oxidase and decarboxylase PP module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113477498|ref|YP_723559.1|
Sequence length 582
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Trichodesmium erythraeum IMS101]
Sequence
MSIDFRSLNTVWSSILVETLHHLGLTTAIISPGYRSTPLTFAFATHPKIETIPILDERSA
AFFALGIAKKNYQPIVIVCTSGTAAANFYPAIIEAKESRIPLLVLTADRPPELRNCHAGQ
TIDQVKLYGNYPNWQIELTLPSVELKRLEYLRQTVIHGWEKTMFPTPGPVHFNIPFRDPL
APINQPEAIALESKFSQNFFASLRPIIRTELIPNSDLIELLKNQFKSHSGIIIAGLAQPE
KPEVYCQAIAKISQTLNFPVLAEGLSPLRNYSQLNPYLISTYDLILRNQKLANKLIPKIV
LQIGELPTSKQLRTWLEAANSHRLIIDQSDHNFDPLHGKTTHLRISVEQLAKILITQYFN
NNHDINYLNLWCQAEEKVRENIDTKMAKINHILEPKISWLISQTLPKNTSIFVANSMPVR
DVEFFWVPNNSQIQPFFNRGVNGIDGTLSTALGIAHRYQKTVMLTGDLALLHDTNGFLLR
NKLVGHLTIILINNQGGGIFEMLPIANFEPPFTEFFATPQEIDFADLCKTYGLEHQKISS
WNQLQQLLNPLPSSGIRILELQTDRQLDARWRLDNLDTFIDL
Download sequence
Identical sequences Q10XD8
WP_011613416.1.43450 gi|113477498|ref|YP_723559.1| 203124.Tery_4077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]