SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477516|ref|YP_723577.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477516|ref|YP_723577.1|
Domain Number 1 Region: 10-330
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113477516|ref|YP_723577.1|
Sequence length 405
Comment FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Trichodesmium erythraeum IMS101]
Sequence
METGEIPQGEKPSNKITKICILGSGFGGLYTALYLNSFWGFKHKNCEVILIDQHDHLVFT
PLLYEVITDELQTWEIAPSFAKLLQNKKILFCQDTIQNIDFKARKVKLLEQGSLAYDYLV
ITVGVTNGKLPTTAENVLTFRTLADAQILEKKLQTLENSNQELIRVSIVGGGPSGVELAG
KIADRLGRRGEIRLIERGKEILKNFTPATRKNAQRALDKRNVLISLETTVDTIEVDKITL
WQSNESVIILTDLVLWTAGTQVREWVKNLNCYHNSRGQLICEQTLQLVGYSEVFALGDIA
EILYPNGKKLPATAQVAYQQASQAAKNLWAILNNKRPKPFRYLHLGEMITLGVNSAAVSS
FGISLHGWLAALVRLSVYLQRLPTFSHGFQVLCNRLKIWLAKRKR
Download sequence
Identical sequences Q10XC0
203124.Tery_4096 gi|113477516|ref|YP_723577.1| WP_011613434.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]