SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477546|ref|YP_723607.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477546|ref|YP_723607.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 1.79e-25
Family Ribosomal protein L28 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113477546|ref|YP_723607.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Trichodesmium erythraeum IMS101]
Sequence
MSRKCQLTGKKANNGYSVSHSHIRTHKLQHANLQWKKVWWPQGKKWVKLKLSTKAIKTLQ
SKGIQAMAKQAGIDLNKF
Download sequence
Identical sequences Q10X90
203124.Tery_4126 WP_011613464.1.43450 gi|113477546|ref|YP_723607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]