SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477892|ref|YP_723953.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|113477892|ref|YP_723953.1|
Domain Number - Region: 7-82
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000876
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113477892|ref|YP_723953.1|
Sequence length 107
Comment hypothetical protein Tery_4494 [Trichodesmium erythraeum IMS101]
Sequence
MRRIDAIGISIGIFVVGGLTYLILQVVGIDSMDAGVWTQAFLVIGLVGWLLSYLFRVSNS
DMTYNQQLKDYEEAVMQKRLEEMTPEELAQLQAEVEQEKATKTHKQK
Download sequence
Identical sequences Q10W94
203124.Tery_4494 WP_011613802.1.43450 gi|113477892|ref|YP_723953.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]