SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477895|ref|YP_723956.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477895|ref|YP_723956.1|
Domain Number 1 Region: 213-538
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.06e-69
Family Integrin alpha N-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 546-655
Classification Level Classification E-value
Superfamily CalX-like 7.98e-30
Family CalX-beta domain 0.00094
Further Details:      
 
Domain Number 3 Region: 653-768
Classification Level Classification E-value
Superfamily CalX-like 1.57e-28
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 4 Region: 772-888
Classification Level Classification E-value
Superfamily CalX-like 3.01e-28
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 5 Region: 889-1000
Classification Level Classification E-value
Superfamily CalX-like 3.92e-27
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 6 Region: 1002-1112
Classification Level Classification E-value
Superfamily CalX-like 5.36e-26
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1131-1218
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000863
Family Collagen-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113477895|ref|YP_723956.1|
Sequence length 1222
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
Sequence
MDEFSPDDHSLFPEEPDETSLNVHYLPGADSNPEVTDPMIQGAWGEVRDELADFILAPEF
DDYIKTAFGETVDPELAKEQIKDVLTGENLPEVIMLPAADMEPAVGAYDPLTGSIYLADS
LLPDTDGVLVDVLLEELGHFLDSQLSESDSPGDEGELLAALVRGEELTQFQVMMLRGQDD
RVDIWVGGVEVEVEASEKVDFEKARNFRAGDRPRSVAAGDFNGDGIPDLAVANYSSDNVS
VLLGKGDGSFGSATNFPVGDGPVSVAVEDFNGDGIPDLAVANWWDDNVSVLSGKGDGSFG
SATNFPVGDHPLSVAAEDLNGDGIPDLAVANWWDDNVSVLSGKGDGSFGSATNFPVGDSP
RSVAVGDFNGDGIPDLAVANFSSANVSVLSGKGDGSFGSATNFPVGNGPFSVAVGDFNGD
GIPDLATANFSSDNVSVLSGKGDGSFGSATNFPVGESPRSVAVGDFNGDGIPDLATANGG
DDNVSVLSGKGDGSFGSATNFPVGDSPRSVAVEDLNGDGIPDLATANFFSDNVSILINKT
PITIIPNITISDTKVTEGNTNKTAKFTVTLDNPTTTTVKVNYTTANQTAKVNQDYKLTKG
TLTFRPGETNKNITVPILGDNRDEPEEKFRVALSRPQNANIKDGRATGTIVDNDPVPQIS
IGDAKITEGNRGQKNMEFEVKLNNPSGKTVKVNYGTQEGSAKSGKDFRNQRGVLTFQPGQ
TKKIVNIPILGDTLDENNEQFQVKLSRAQNGKFSDNTAVGRIIDNDETLPQKTPQISIGD
GEIVEGDRGQKKMTFQVKLSNPSNKTVTVNYTTVDGSAKSGKDFQRKSGVVTFRPGETKK
TVNISVFGDVFLENLELFQVKLTSAQNGEFSGQRDQFATGIIQDNDKPPQISISDSKVTE
GNRGKKNMEFEVKLNNPSDRTVRVNYETVEGSAKSGKDFQNQKGVVTFKPGQTKKTVNVP
TLGDTFVEKTEQFQVKLSGAQNAELSDSKGVGRIQDNDIVPKISIRDARTTEGDRGQKNM
KFEVKLDNSSSQTVKVNYETVEGSAKSGEDFQKKKGVLTFKPGERKKTVNVPILGDTDDE
ANEKFEVRLSGAKNGKLSDGKAVGIIRDNDREAIDLGVLSEKAIFKADNIGFTTGVNRNI
EDYFRFEVKKEGLVNIFMDVFVQDIGMELYDQDDSLLFQSNVEGLGFEAIENVLEPGVYY
LRVFPVGPSRTKYNLSINIIES
Download sequence
Identical sequences Q10W91
WP_011613805.1.43450 gi|113477895|ref|YP_723956.1| 203124.Tery_4497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]