SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113477896|ref|YP_723957.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113477896|ref|YP_723957.1|
Domain Number 1 Region: 213-538
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.14e-65
Family Integrin alpha N-terminal domain 0.0035
Further Details:      
 
Domain Number 2 Region: 772-888
Classification Level Classification E-value
Superfamily CalX-like 2.35e-29
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 3 Region: 546-655
Classification Level Classification E-value
Superfamily CalX-like 3.79e-29
Family CalX-beta domain 0.00098
Further Details:      
 
Domain Number 4 Region: 653-768
Classification Level Classification E-value
Superfamily CalX-like 1.31e-28
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 5 Region: 1003-1114
Classification Level Classification E-value
Superfamily CalX-like 3.27e-27
Family CalX-beta domain 0.00089
Further Details:      
 
Domain Number 6 Region: 888-1001
Classification Level Classification E-value
Superfamily CalX-like 4.71e-27
Family CalX-beta domain 0.00094
Further Details:      
 
Domain Number 7 Region: 1137-1221
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000000000353
Family Collagen-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113477896|ref|YP_723957.1|
Sequence length 1225
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
Sequence
MDEFSPDDHSLFPEEPDETSLNVHYLPGADSNPEVTDPMIQGAWGEVRDELADFILAPEF
DDYIKTAFGETVDPELAKEQIKDVLTGENLPEVIMLPAADMEPAVGAYDPLTGSIYLADS
LLPDTDGVLVDVLLEELGHFLDSQLSESDSPGDEGELLAALVRGEELTQFQVMMLRGQDD
RVDIWVGGVEVEVEASEKVDFEKARNFKVGVLPVSVAVGDFDGDGIPDLAVANFSSENVS
VLLGKGDGSFGSATNFPVGDGANRMVAGDFNGDGIPDLAVPSSRDDNVSVLSGKGDGSFG
SPTNFPVGDWPFFLAAEDFNGDGIPDLAVANLSSDNVSVLLGKGDGSFGSATNFPVGDEP
ISVAVEDFNGDGIPDLAVANGGDNNVSVLSGKGDGSFGSATNFPVGDRPFSVAAEDLNGD
GIPDLAVANGGDDNVSVLSGKGDGSFGSATNFPVGDRPASVAVGDFNGDGIPDLAVANNG
SDNVSVLSGKDDGSFGSATNFPVGDGPISVAAEDLNGDGIPDLATANEFSDNVSILINKT
PITIIPNITISDTKLTEGNTNKTAKFTVTLDNPTTTTVKVNYTTANQTAKVNQDYKLTKG
TLTFRPGETNKNITVPILGDNRDEPQEKFRVALSRPQNANIKDGRATGTIVDNDPVPQIS
IGDAKITEGNRGQKNMEFEVKLNNPSGKTVRVNYGTQEGSAKSGKDFRNQRGVLTFQPGQ
TKKIVNIPILGDTLDENNEQFQVKLSRAQNGNFSDNTAVGRIIDNDETLPQKTPQISIGD
GEIVEGDRGQKKMTFQVKLSNPSNKTVTVNYTTVDGSAKSGKDFQQKSGVVTFRPGETKK
TVNVSVLGDALSENLELFQVKLTSAQNGKFSAQTDQYATGIIQDNDQPQISISDAKITEG
NRDKKNMKFEVKLNSASNQTVKVNYETIDGSAKSGKDYEKKSGVVIFKPGQTRKTINIST
LGDTLSENLELFQVKLSGAQNGEFSAQTDQYATAIIQDNDKLPEISISDAKITEGNTEKK
EMEFEVKLDKSSTQTVKVNYETVEGSAKSGKDFQKKRGVVIFKPGETKKTVNVPILGDTD
NEANEKFEVILSSPKNANLSDGKGVGTIQDNDREAIDLGVLSEKPILKSDKIGFTTGGAN
RDTEDYFRFEVEKEGLVNIFMDSFVQNIGMELYDQDDSLLFRSNVDGLGLEAINKTLDPG
IYYLRVFPVGSNRTTYNLSINIVER
Download sequence
Identical sequences Q10W90
gi|113477896|ref|YP_723957.1| WP_011613806.1.43450 203124.Tery_4498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]