SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113478028|ref|YP_724089.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478028|ref|YP_724089.1|
Domain Number 1 Region: 47-331
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.65e-35
Family TK-like PP module 0.0047
Further Details:      
 
Domain Number 2 Region: 381-579
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.81e-31
Family TK-like Pyr module 0.03
Further Details:      
 
Domain Number 3 Region: 585-734
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000471
Family Transketolase C-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113478028|ref|YP_724089.1|
Sequence length 736
Comment transketolase, central region [Trichodesmium erythraeum IMS101]
Sequence
MTTTTPKPTTVPDFCEGIQYFGKAWPDFETYGKTPAIAEGSKAIASPSDPTGIYQTLLYA
DALRYLMLQVTGSKASGHPGGFASQAEAYAALVMLGYKNILTEVGHHAPGFYSAVFLDRS
LEDMKIFSVQQMRDRFREMHGLLGHLSGYIPGLLNPAGPLGQGQHFAMAAALLHQNTLFP
FTLGDGGMGEPYPVSSMMHFNTAYPNVTNFLPVLVWNGYSQEHHSMVSTKSNAEMISYWK
GNGFAEVILVDAKDFDDQNQPGDYIDSSAFSLEKRLEFTKAVLENVDKAAKSALDGKLTI
FIIKQLKGAGVHARGSKSHNLYPKDTLDSPQIINTLKERALSVAAWELVRKNCERAGGGP
ASKTVVTEFEYPLTELGQLPLEEYTVGGDPKVATTAMGALIAHVGQKDPHFLLTNADGNA
ASGINNVNQALKIIHPTPDDIYFQGPGGQVYEPLSEDACAGMAAALALMGARTVWCSYES
FAINGVPIWQTVTQAMAELRHLTPSTITLFTAGALEQGRNGWTHQRPEIEAYFAAMMRNG
NVFALFPPDANSIQVCYDWALSTKNKGVTITASKSPLPIRTTFEQARQGLKDGAVILQEV
KGGQTVVFAVLGDLPLIPVFEAAAYLETKGIGVRIVSVINPRRLYRPQDTGWNTCSEADG
GFLDDAGFEELFGGDALIAVTGGASLMLEPIMLRSQVKRDTFAWRRGETASSAGEVMAFN
GITAETLTKRAIELVD
Download sequence
Identical sequences Q10VV8
WP_011613933.1.43450 gi|113478028|ref|YP_724089.1| 203124.Tery_4645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]