SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113478073|ref|YP_724134.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478073|ref|YP_724134.1|
Domain Number 1 Region: 3-290
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.46e-77
Family AstE/AspA-like 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113478073|ref|YP_724134.1|
Sequence length 293
Comment aspartoacylase [Trichodesmium erythraeum IMS101]
Sequence
MKKINKLAIVGGTHGNEFTGIYLVKKFEEFPELISRRNFDTQTLLANPQGFELVKRYIDT
DLNRCFKVEDLENNTSLNYEESRAKFINQMLGPKGNPKFDFILDLHTTTANMGLTIILVN
YHPFNLKIATYLSSVEPNLKIYTCFNPEVENTFINSICERGFAIEVGPIAQGILQADLFY
KTEKLVQISLDFIEHFNEGKLDHINRDIVIYKHLKVVDYPKTKDGEIVAMIHPQLQGRDY
QKLSPGEPMFLTFDNQTIYYQEESPVWPVFINEAAYYEKGIAMCLTKKESIRV
Download sequence
Identical sequences Q10VR3
203124.Tery_4698 WP_011613978.1.43450 gi|113478073|ref|YP_724134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]