SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113478091|ref|YP_724152.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478091|ref|YP_724152.1|
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily IpsF-like 4.71e-65
Family IpsF-like 0.00000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113478091|ref|YP_724152.1|
Sequence length 165
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Trichodesmium erythraeum IMS101]
Sequence
MNVRIGNGYDIHKLGPERPLILGGIKIDHEMGLIGHSDADVLTHAIMDAMLGALSLGDIG
HYFPPSDPQWAGADSIDLLKRVNDLVRGVCWRISNIDSVVVAERPKLKPHIEKMRSRLAT
TLELEADQVSIKATTNEKLGPVGREEGIAAYAVVLLQKYTEIRKA
Download sequence
Identical sequences Q10VP5
203124.Tery_4716 gi|113478091|ref|YP_724152.1| WP_011613996.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]